Recombinant Mouse Fat storage-inducing transmembrane protein 1 (Fitm1)

What is Fitm1 and what is its basic structure?

Fitm1 (Fat storage-inducing transmembrane protein 1) is an evolutionarily conserved protein that belongs to the FITM family involved in lipid storage. The mouse Fitm1 protein is 292 amino acids in length and contains six transmembrane domains with both N and C termini facing the cytosol . The protein is exclusively localized to the endoplasmic reticulum (ER) and plays a crucial role in mediating triglyceride-rich lipid droplet (LD) accumulation . Unlike other proteins involved in lipid metabolism, Fitm1 does not synthesize triglyceride but instead functions to partition triglyceride into LDs .

The full amino acid sequence of mouse Fitm1 includes regions that are critical for its membrane topology and function, beginning with "MERGPTVGAGLGAGTRVRALLGCLVKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWL" and continuing through its entire 292-amino acid sequence . This protein structure supports its specialized function in lipid metabolism, particularly in skeletal muscle tissue.

How does Fitm1 expression differ from Fitm2, and what are their unique tissue distributions?

While Fitm1 and Fitm2 share approximately 50% similarity at the amino acid level, they have distinct tissue expression patterns that suggest specialized physiological roles:

Fitm1 is almost exclusively expressed in skeletal muscle with lower expression in cardiac tissue, while Fitm2 is ubiquitously expressed at low levels throughout the body but has particularly high expression in adipose depots . This distinct tissue distribution suggests that Fitm2-driven LD formation may have a role in long-term triglyceride storage in adipose tissue, whereas Fitm1 forms smaller LDs that are characteristic of the rapidly turning over LDs found in skeletal muscle . This differentiation suggests that Fitm1-directed LD formation may play a specific role in linking myocellular triglyceride energy reservoirs to mitochondrial respiration .

What are the primary methodologies used to study Fitm1 function in lipid metabolism?

Research on Fitm1 function typically employs several complementary approaches:

• Protein Purification and Binding Assays: Researchers purify Fitm1 in detergent micelles to study its direct binding to triglycerides and other lipids with specificity and saturation-binding kinetics .

• Mutagenesis Studies: Creating gain-of-function and loss-of-function mutants allows researchers to correlate structural features with functional outcomes. For example, the FIT2 gain-of-function mutant FLL(157–9)AAA showed increased binding to triolein and formed larger LDs, while the FIT2 N80A mutant had significantly lower triolein binding and produced smaller LDs .

• Cellular Overexpression and Knockdown: Manipulating Fitm1 expression levels in cell culture and animal models helps determine its effects on LD formation and triglyceride partitioning without affecting triglyceride biosynthesis .

• Microscopy Techniques: Fluorescence and electron microscopy are employed to visualize and quantify LD formation, size, and number in response to Fitm1 manipulation .

• Transcriptional Regulation Studies: Examining how transcription factors like MyoD1 and PGC-1α regulate Fitm1 expression provides insights into its role during muscle development and in response to metabolic demands .

These methodologies collectively enable researchers to dissect the complex role of Fitm1 in lipid droplet biology and cellular metabolism.

What is the molecular mechanism of Fitm1's direct interaction with triglycerides?

The molecular mechanism by which Fitm1 interacts with triglycerides represents a unique biochemical paradigm in lipid metabolism. Studies have demonstrated that purified Fitm1 protein directly binds to triolein (a triglyceride) with specificity and saturation-binding kinetics . This direct binding ability distinguishes Fitm proteins from other proteins involved in lipid metabolism.

The binding mechanism involves:

• Specific Binding Sites: Although Fitm1 binds triglycerides more weakly than Fitm2, both proteins possess specific regions that facilitate lipid binding .

• Structural Requirements: The transmembrane domains of Fitm1 are critical for its interaction with triglycerides, suggesting a membrane-embedded binding pocket .

• Binding Specificity: Fitm1 shows specificity for triglycerides but may also interact with other lipid species, albeit with different affinities. This specificity is important for its function in partitioning specific lipids into lipid droplets .

• Functional Correlation: The strength of triglyceride binding correlates with the ability to form lipid droplets. Mutations that alter this binding capacity directly affect lipid droplet size and number .

This direct binding mechanism is essential for Fitm1's role in facilitating the partitioning of triglycerides into nascent lipid droplets at the ER membrane, representing a fundamental step in lipid droplet biogenesis that occurs independently of triglyceride synthesis .

How do FIT proteins promote lipid droplet budding from the endoplasmic reticulum?

The process of lipid droplet budding from the ER involves several coordinated steps in which FIT proteins play crucial roles:

• Initial Lens Formation: Neutral lipids synthesized in the ER membrane initially form a lens between the two leaflets of the ER bilayer .

• FIT Protein Involvement: FIT proteins facilitate the progression from lens formation to actual lipid droplet budding. When FIT proteins are depleted, cells exhibit inhibited lipid droplet budding, resulting in the accumulation of neutral lipid lenses embedded in the ER membrane .

• Potential Mechanisms: Several mechanisms have been proposed for how FIT proteins promote budding:

  • Direct binding to neutral lipids like diacylglycerols and triacylglycerols

  • Modulation of diacylglycerol levels in the ER, as increased diacylglycerol disfavors lipid droplet budding

  • Phosphatase activity on phosphatidic and lysophosphatidic acid, as suggested by similarities between FITs and lipid phosphate phosphatases

• Coordination with Other Proteins: FIT proteins may work in concert with other proteins like perilipins that access nascent lipid droplets from the cytosolic side, potentially changing the balance of tension between membrane monolayers to facilitate budding .

The precise molecular details of how Fitm1 coordinates these processes are still being investigated, but its role appears essential for the proper formation and budding of lipid droplets, particularly in skeletal muscle where it is predominantly expressed .

What are the comparative binding properties of Fitm1 versus Fitm2, and how do they relate to function?

The differential binding properties of Fitm1 and Fitm2 correlate with their distinct tissue distributions and functional roles:

Fitm2 strongly binds triglycerides, which aligns with its role in adipose tissue where long-term triglyceride storage is crucial . In contrast, Fitm1 binds triglycerides more weakly, which may facilitate the formation of smaller lipid droplets characteristic of skeletal muscle .

This functional differentiation suggests that Fitm1-directed LD formation may be specifically adapted for the metabolic needs of skeletal muscle, where rapid lipid turnover is essential for energy production through fatty acid oxidation . The dynamics of LD turnover for the release of fatty acids would be expected to play an important role in the maintenance of energy homeostasis in tissues such as skeletal muscle that rely heavily on fatty acid oxidation for ATP production .

These comparative binding properties highlight how structural differences between highly related proteins can translate into specialized physiological functions in different tissues, optimizing lipid storage and utilization based on tissue-specific metabolic requirements .

How is Fitm1 expression regulated during muscle development and in response to metabolic challenges?

Fitm1 expression in skeletal muscle is subject to complex regulatory mechanisms that respond to developmental cues and metabolic states:

• Developmental Regulation:

  • The MyoD1 transcription factor promotes Fitm1 transcription by binding to the E-box element in the core promoter region of Fitm1 during C2C12 myoblast differentiation

  • This finding establishes Fitm1 as a novel target for MyoD1 during muscle development, linking lipid metabolism regulation to muscle differentiation programs

• Metabolic Regulation:

  • In primary human skeletal muscle cells, the transcriptional coactivator peroxisome proliferator-activated receptor-gamma coactivator 1 alpha (PGC-1α) stimulates the expression of Fitm1 at both mRNA and protein levels

  • PGC-1α-induced Fitm1 expression enhances the formation of smaller lipid droplets with only a modest increase in triacylglycerol content in oleate-incubated skeletal muscle cells

  • This regulation by PGC-1α, a master regulator of mitochondrial biogenesis and oxidative metabolism, suggests Fitm1 plays a role in coordinating lipid storage with energy expenditure in muscle

• Hormonal and Dietary Influences:

  • Evidence suggests that hormonal factors like dihydrotestosterone can influence Fitm expression when combined with dietary interventions like high-glycemic diets

  • These findings indicate that Fitm1 expression responds to complex interactions between hormonal signals and nutritional status

The regulated expression of Fitm1 in muscle tissue likely serves to coordinate lipid droplet formation with the metabolic demands of muscle during development, exercise, and varying nutritional states, helping to maintain proper energy homeostasis while preventing lipotoxicity .

What are the implications of Fitm1 dysfunction in metabolic disorders and potential therapeutic applications?

The role of Fitm1 in lipid metabolism suggests important implications for metabolic disorders:

• Metabolic Disease Associations:

  • While Fitm2 has been more extensively studied in relation to metabolic diseases like type 2 diabetes, lipodystrophy, cardiac disease, and hepatocellular carcinoma, Fitm1's muscle-specific expression suggests it may play a role in muscle-related metabolic disorders

  • Dysregulation of proper lipid storage in muscle can contribute to insulin resistance and metabolic dysfunction

  • The role of Fitm1 in forming smaller, rapidly-turning-over lipid droplets in muscle may be crucial for maintaining insulin sensitivity and proper fatty acid utilization

• Potential Therapeutic Applications:

  • Targeting Fitm1 could potentially modulate intramuscular lipid storage and utilization, which may be beneficial in conditions characterized by altered muscle metabolism

  • Enhancing Fitm1 activity might promote the formation of smaller, more metabolically active lipid droplets in muscle, potentially improving fatty acid oxidation and insulin sensitivity

  • Conversely, in conditions of excessive muscle wasting or increased energy demand, modulating Fitm1 might help preserve essential intramuscular energy stores

• Research Considerations:

  • Investigating the interaction between Fitm1 and key metabolic regulators like PGC-1α could provide insights into therapeutic approaches for metabolic diseases

  • Understanding how Fitm1 coordinates with mitochondrial function in muscle could inform interventions aimed at improving metabolic flexibility

  • The tissue-specific expression pattern of Fitm1 offers the potential for targeted therapeutic approaches that might minimize off-target effects in other tissues

While specific therapeutic applications targeting Fitm1 are still in early research stages, its fundamental role in muscle lipid metabolism suggests it could be an important target for addressing muscle-specific aspects of metabolic disorders .

What are the optimal conditions for studying recombinant Fitm1 protein in vitro?

When working with recombinant mouse Fitm1 protein, several technical considerations are essential for successful experimental outcomes:

• Storage and Stability:

  • Store recombinant Fitm1 at -20°C for regular use, or at -80°C for extended storage

  • Avoid repeated freezing and thawing cycles, as this can compromise protein integrity

  • Working aliquots can be stored at 4°C for up to one week

• Buffer Composition:

  • Optimal storage in Tris-based buffer with 50% glycerol, specifically formulated for Fitm1 stability

  • Buffer composition should be maintained throughout experimental procedures to ensure protein stability

• Purification Approaches:

  • For binding studies, purification in detergent micelles has been successfully employed to maintain protein folding and activity

  • The choice of detergent is critical, as it must maintain protein structure while allowing lipid binding studies

• Binding Assay Design:

  • When studying lipid binding, consider that Fitm1 has weaker triglyceride binding than Fitm2, which may require more sensitive detection methods

  • Incorporate appropriate controls, including Fitm2 as a positive control for strong binding and non-binding proteins as negative controls

• Tag Considerations:

  • The tag type used for recombinant Fitm1 should be carefully selected as it may affect protein function

  • Validation experiments should confirm that the tag does not interfere with the protein's lipid binding properties or interactions with other proteins

These technical considerations ensure that experiments with recombinant Fitm1 yield reliable and reproducible results, particularly when investigating its lipid binding properties and functional characteristics.

How can researchers effectively compare Fitm1 and Fitm2 functions in cellular models?

To effectively compare the functions of Fitm1 and Fitm2 in cellular models, researchers should consider the following methodological approaches:

• Cell Model Selection:

  • Choose cell types that reflect the natural expression patterns: muscle cells (C2C12, primary myocytes) for Fitm1 and adipocytes (3T3-L1) for Fitm2

  • Alternatively, use a neutral cell background (like HEK293) for direct comparison with controlled expression levels

• Expression Systems:

  • Employ matched expression vectors with identical promoters and tags to ensure comparable expression levels

  • Consider inducible expression systems to control the timing and level of protein expression

• Functional Assays:

  • Lipid Droplet Quantification: Measure number, size, and distribution of lipid droplets using fluorescent lipid dyes and confocal microscopy

  • Triglyceride Partitioning: Assess the efficiency of triglyceride incorporation into lipid droplets versus membrane-embedded triglyceride accumulation

  • Lipid Turnover Kinetics: Measure the rate of fatty acid incorporation into and release from lipid droplets using pulse-chase experiments with labeled fatty acids

• Comparative Analysis Framework:

  • Directly compare lipid droplet formation efficiency (per unit of protein expressed)

  • Analyze differences in lipid droplet morphology and distribution

  • Assess lipid droplet stability and turnover rates under basal and stimulated conditions

  • Examine interactions with other proteins involved in lipid metabolism

• Knockout and Rescue Experiments:

  • Generate knockout cell lines for both Fitm1 and Fitm2 using CRISPR/Cas9

  • Perform cross-rescue experiments to determine whether Fitm1 can compensate for Fitm2 deficiency and vice versa

  • Create chimeric proteins exchanging domains between Fitm1 and Fitm2 to identify regions responsible for functional differences

By systematically applying these approaches, researchers can dissect the specific contributions of Fitm1 and Fitm2 to lipid droplet biology and understand how their differential expression patterns relate to tissue-specific lipid metabolism requirements .

What are the unexplored aspects of Fitm1 biology that merit further investigation?

Several important aspects of Fitm1 biology remain incompletely understood and represent promising avenues for future research:

• Structural Biology:

  • Determining the three-dimensional structure of Fitm1, particularly in complex with lipid substrates

  • Identifying the specific amino acid residues involved in triglyceride binding and how they differ from Fitm2

  • Understanding the conformational changes that occur during lipid binding and transfer

• Regulatory Networks:

  • Comprehensive mapping of transcription factors and cofactors that regulate Fitm1 expression in different physiological states

  • Investigating post-translational modifications that may regulate Fitm1 activity

  • Exploring potential circadian regulation of Fitm1 expression and activity in muscle

• Metabolic Integration:

  • Determining how Fitm1-mediated lipid droplet formation integrates with exercise adaptation in skeletal muscle

  • Investigating the role of Fitm1 in muscle fiber-type specific metabolism

  • Understanding how Fitm1 activity coordinates with mitochondrial function and fatty acid oxidation

• Pathophysiological Roles:

  • Exploring Fitm1 expression and function in muscle disorders and insulin resistance

  • Investigating potential roles in muscle aging and sarcopenia

  • Examining whether Fitm1 dysfunction contributes to ectopic lipid accumulation and lipotoxicity

• Interactome Analysis:

  • Identifying protein-protein interactions specific to Fitm1 in the muscle context

  • Investigating potential interactions with muscle-specific proteins involved in energy metabolism

  • Determining whether Fitm1 participates in specialized protein complexes at ER-lipid droplet contact sites

These research directions would significantly advance our understanding of Fitm1's specialized role in muscle lipid metabolism and could potentially reveal new therapeutic targets for metabolic disorders affecting skeletal muscle .

How might emerging technologies advance our understanding of Fitm1 function?

Emerging technologies offer exciting opportunities to deepen our understanding of Fitm1 biology:

• Cryo-Electron Microscopy and Structural Approaches:

  • High-resolution structural analysis of Fitm1 in native membrane environments

  • Visualization of conformational changes during lipid binding and transfer

  • Structural comparisons between Fitm1 and Fitm2 to understand functional differences

• Advanced Imaging Techniques:

  • Super-resolution microscopy to visualize Fitm1 localization and dynamics at ER-lipid droplet interfaces

  • Live-cell imaging with fluorescently tagged Fitm1 to track protein movement during lipid droplet formation

  • Correlative light and electron microscopy to connect protein localization with ultrastructural features

• Single-Cell Omics:

  • Single-cell transcriptomics to identify cell-specific expression patterns of Fitm1 in heterogeneous muscle tissues

  • Spatial transcriptomics to map Fitm1 expression within muscle architecture

  • Proteomics at the single-cell level to identify cell-specific Fitm1 interaction networks

• Genome Editing and High-Throughput Screening:

  • CRISPR-based screens to identify genetic modifiers of Fitm1 function

  • Creation of tissue-specific conditional knockout models to study temporal aspects of Fitm1 function

  • Base editing approaches to introduce specific mutations to test structure-function relationships

• Computational and Systems Biology:

  • Molecular dynamics simulations to model Fitm1-lipid interactions

  • Network analysis to place Fitm1 within the broader context of cellular metabolism

  • Machine learning approaches to predict functional outcomes of Fitm1 variants

These technological advances would enable researchers to address fundamental questions about Fitm1 biology that have been challenging to approach with conventional methods, potentially leading to breakthroughs in our understanding of lipid metabolism in muscle and other tissues .

What are the key considerations for researchers beginning work with recombinant Fitm1?

Researchers initiating studies with recombinant mouse Fitm1 should consider several practical aspects to ensure successful experiments:

• Research Design Planning:

  • Clearly define whether you're studying basic binding properties, cellular functions, or physiological roles

  • Consider the appropriate experimental system (in vitro binding assays, cell culture, or animal models)

  • Plan for appropriate controls, including comparison with Fitm2 where relevant

• Technical Requirements:

  • Ensure proper handling of recombinant protein: store at -20°C or -80°C for extended storage

  • Work with aliquots at 4°C for up to one week to avoid repeated freeze-thaw cycles

  • Use the recommended Tris-based buffer with 50% glycerol for optimal stability

• Expression Systems:

  • When expressing recombinant Fitm1 in cellular systems, consider the endogenous expression of Fitm1 and Fitm2

  • Be aware that overexpression may lead to non-physiological effects on lipid droplet formation

  • Consider using inducible expression systems to control expression levels

• Analytical Approaches:

  • Develop robust assays for lipid binding that account for Fitm1's relatively weak binding compared to Fitm2

  • Implement quantitative microscopy techniques to accurately assess lipid droplet number, size, and distribution

  • Consider biochemical approaches to measure triglyceride partitioning between membranes and lipid droplets

• Interdisciplinary Considerations:

  • Integrate lipidomic analyses to comprehensively assess effects on lipid metabolism

  • Consider combining with transcriptomic approaches to understand regulatory networks

  • Incorporate biophysical techniques to study membrane interactions and protein dynamics

By carefully considering these practical aspects, researchers can develop robust experimental approaches to study Fitm1 biology and its role in lipid metabolism, particularly in the context of skeletal muscle physiology and pathophysiology .

How does understanding Fitm1 contribute to our broader knowledge of lipid metabolism?

The study of Fitm1 provides several important contributions to our broader understanding of cellular lipid metabolism:

• Organelle Coordination in Lipid Homeostasis:

  • Fitm1 exemplifies how proteins at the ER facilitate communication between organelles in lipid metabolism

  • Understanding Fitm1 function illuminates how lipid droplets serve as dynamic hubs coordinating cellular metabolism and facilitating communication between different organelles

  • This coordination is critical for buffering the levels of potentially toxic lipid species and maintaining cellular health

• Tissue-Specific Lipid Metabolism:

  • The distinct expression patterns and properties of Fitm1 versus Fitm2 highlight how lipid storage mechanisms are specialized for tissue-specific needs

  • In skeletal muscle, Fitm1-mediated formation of smaller lipid droplets may facilitate rapid lipid turnover needed for energy production during exercise

  • This specialization reflects broader principles of how tissues optimize metabolic pathways to meet their unique physiological demands

• Lipid Droplet Biogenesis Mechanisms:

  • Fitm1's role in lipid droplet formation reveals fundamental principles about how cells organize and store neutral lipids

  • The direct binding of triglycerides by Fitm1 represents a unique biochemical mechanism distinct from lipid synthetic enzymes

  • This mechanism provides insights into the initial steps of lipid droplet formation at the ER membrane

• Integration of Lipid Storage and Energy Metabolism:

  • Fitm1's regulation by metabolic factors like PGC-1α demonstrates how lipid storage is integrated with broader energy homeostasis pathways

  • This integration ensures that lipid storage and utilization are coordinated with cellular energy needs

  • Understanding these relationships provides insights into how metabolic dysregulation can lead to disease states

• Evolution of Lipid Storage Mechanisms:

  • The evolutionary conservation of FIT proteins across eukaryotes, with Fitm1 appearing as early as bony fish, highlights the fundamental importance of regulated lipid storage

  • The diversification of Fitm1 and Fitm2 in higher organisms reflects evolutionary adaptation to complex multicellular metabolism