Recombinant Mouse Fatty acid 2-hydroxylase (Fa2h)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Fatty Acid 2-Hydroxylase (FA2H)

Recombinant Mouse Fatty Acid 2-Hydroxylase (FA2H) is a genetically engineered enzyme expressed in laboratory systems to study its role in lipid metabolism, myelination, and neurological disorders. This enzyme catalyzes the 2-hydroxylation of fatty acids, a critical step in synthesizing 2-hydroxy galactolipids (e.g., galactosylceramide and sulfatide) that are enriched in myelin sheaths of the central and peripheral nervous systems . Recombinant FA2H is produced using expression vectors in bacterial, mammalian, or yeast systems, often with purification tags (e.g., His, GST) for ease of isolation .

Biochemical Role and Mechanism

FA2H is a conserved cytochrome b5-dependent oxidase that hydroxylates the N-acyl chain of ceramides or free fatty acids . This reaction introduces a hydroxyl group at the α-position, enabling tighter lipid packing in myelin membranes through hydrogen bonding and carbohydrate-carbohydrate interactions . Key features include:

PropertyDetail
Substrate SpecificityPrefers long-chain unsaturated fatty acids (C16-C24)
CofactorsRequires cytochrome b5 and NADPH for enzymatic activity
LocalizationEndoplasmic reticulum, with activity linked to myelin lipid synthesis

Expression Systems and Production

Recombinant Mouse FA2H is commercially available in diverse expression platforms:

SystemTags/PurificationApplications
BacterialHis, GSTHigh-yield production for biochemical assays
MammalianDDK, MycNative folding for structural studies
YeastAvi, FcGlycosylated forms for signaling research

Source: Creative BioMart

Developmental Regulation

FA2H expression peaks during myelination in both CNS and PNS:

Stage2-Hydroxy Fatty Acids in GalactolipidsKey Observations
Neonatal (4d)~5% (GalCer), ~35% (Sulfatides) Low myelination, minimal lipid hydroxylation
Adult (60d)~60% (GalCer), ~35% (Sulfatides) High myelination, FA2H-driven lipid maturation

Data from rat sciatic nerve studies

Functional Studies

  • RNA Interference (RNAi): Knockdown of FA2H in Schwann cells reduced 2-hydroxy fatty acids by >50% and increased cell migration .

  • Enzyme Inhibition: Anti-FA2H antibodies blocked fatty acid 2-hydroxylase activity in mouse brain, confirming its role in myelin lipid synthesis .

Applications in Research and Disease Models

Recombinant FA2H is used to:

  1. Model Leukodystrophies: Mutations in FA2H cause autosomal recessive spastic paraplegia (SPG35), characterized by myelin defects .

  2. Study Lipid Metabolism: Recombinant FA2H aids in understanding 2-hydroxy sphingolipid biosynthesis in sphingolipid de novo pathways .

  3. Therapeutic Development: Testing enzyme replacement or gene therapy strategies for demyelinating disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Fa2h; Faah; Fatty acid 2-hydroxylase; Fatty acid alpha-hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fa2h
Target Protein Sequence
MAPAPPPAASFTPAEVQRRLAAGACWVRRGASLYDLTSFVRHHPGGEQLLLARAGQDISA DLDGPPHRHSDNARRWLEQYYVGELRADPQDPTENGAVASAETQKTDPALEPQFKVVDWD KDLVDWQKPLLWQVGHLGEKYDEWVHQPVARPIRLFHSDLIEAFSKTVWYSVPIIWVPLV LYLSWSYYRTLTQDNIRLFASLTREYSMMMPESVFIGLFVLGMLFWTFVEYVIHRFLFHM KPPSNSHYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGII FAGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEYQKSGFGISTKLWDYFFH TLIPEEAHPKMQ
Uniprot No.

Target Background

Function
Fatty acid 2-hydroxylase (FA2H) catalyzes the hydroxylation of free fatty acids at the C-2 position, producing 2-hydroxy fatty acids. These are crucial building blocks for sphingolipids and glycosphingolipids prevalent in neural tissue and epidermis. FA2H exhibits stereospecificity for the production of (R)-2-hydroxy fatty acids. It plays a vital role in myelin sheath galactosphingolipid synthesis, epidermal lamellar body formation (essential for skin barrier function), and sebaceous gland glycosphingolipid and wax diester synthesis (regulating hair follicle homeostasis). Furthermore, FA2H participates in plasma membrane raft sphingolipid synthesis, influencing lipid raft mobility and the trafficking of associated proteins.
Gene References Into Functions
  1. Highlights the importance of sebaceous glands and specific sebum lipids (synthesized by FA2H) in hair follicle homeostasis. PMID: 21628453
  2. Provides the first evidence of FA2H's significant function beyond oligodendrocytes in the central nervous system. PMID: 21491498
  3. Demonstrates that deleting FA2H doesn't significantly affect the phenotype of Cgt-/- mice, suggesting that HFA-GlcCer and HFA-sphingomyelin don't functionally compensate for the loss of HFA-GalCer. PMID: 21366909
  4. Documents FA2H's novel role in adipocyte lipogenesis, potentially by modulating raft fluidity and GLUT4 levels. PMID: 20519515
  5. Establishes FA2H as the enzyme responsible for alpha-hydroxylated ceramide formation in mammalian brain oligodendrocytes. PMID: 15658937
  6. Identifies FA2H as the primary fatty acid 2-hydroxylase in the brain, initiating the synthesis of 2-hydroxy galactolipids. PMID: 16998236
Database Links
Protein Families
Sterol desaturase family, SCS7 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain (at protein level). Detected in cerebellum and forebrain. Expression in the white matter is mainly restricted in oligodendrocytes. Expressed in stomach, kidney, skin and testis. Expressed in sebaceous gland.

Q&A

What is mouse FA2H and what is its primary function?

Mouse fatty acid 2-hydroxylase (FA2H) is an enzyme that catalyzes the addition of a hydroxyl group to the C2 position of fatty acids, creating 2-hydroxylated fatty acids. Its primary function is modifying fatty acids by adding a single oxygen atom to a hydrogen atom at a specific position, resulting in 2-hydroxylated fatty acids . These modified fatty acids are crucial components of sphingolipids, particularly those found in myelin, the protective covering that insulates nerves and ensures rapid transmission of nerve impulses . The 2-hydroxylation process occurs during de novo ceramide synthesis and is essential for the formation of myelin galactosylceramides and sulfatides . In mouse brain studies, FA2H has been identified as the major fatty acid 2-hydroxylase, with 2-hydroxylation of free fatty acids being the first step in the synthesis of 2-hydroxy galactolipids .

How is FA2H expression regulated during mouse development?

FA2H expression in mice shows distinct temporal and spatial regulation, particularly during postnatal development. In mouse brain, FA2H expression is relatively low at birth but increases significantly during the course of myelination . The upregulation of FA2H expression coincides with increased levels of free 2-hydroxy fatty acids and with measurable fatty acid 2-hydroxylase activity . During postnatal mouse brain development, the relative ratio of 2-hydroxy versus nonhydroxy galactolipids changes dramatically, increasing from approximately 8% of total galactolipids at 2 days of age to 6-8 fold higher by 30 days of age . Northern blot analysis has demonstrated that FA2H is highly expressed in brain and colon tissues in adult mice . The correlation between FA2H expression and myelination processes suggests that its regulation is tightly linked to developmental programs controlling nervous system maturation.

What are the structural characteristics of mouse FA2H protein?

The mouse FA2H protein shares significant structural similarities with its human counterpart. Key structural features include:

  • An N-terminal cytochrome b5 domain, which is essential for enzymatic activity

  • Four potential transmembrane domains, indicating its localization to membrane structures

  • An iron-binding histidine motif, which is conserved among membrane-bound desaturases/hydroxylases and likely involved in catalytic function

Functional studies have demonstrated that FA2H lacking the N-terminal cytochrome b5 domain has little catalytic activity, confirming that this domain is a critical functional component of the enzyme . The protein requires NADPH and NADPH:cytochrome P-450 reductase for its hydroxylase activity, operating in an NADPH-dependent manner . These structural characteristics place FA2H in the family of membrane-bound desaturases/hydroxylases and provide insights into its catalytic mechanism and membrane localization.

What experimental approaches can validate FA2H enzymatic activity?

Validating FA2H enzymatic activity requires specialized assays that account for its membrane-bound nature and specific substrate requirements. Key approaches include:

  • Microsomal enzyme assays: Using microsomal fractions prepared from tissues or cells expressing FA2H to measure the conversion of fatty acid substrates to 2-hydroxy fatty acids in the presence of NADPH and NADPH:cytochrome P-450 reductase

  • Immunoinhibition studies: FA2H activity in mouse brain preparations can be inhibited by specific anti-FA2H antibodies, confirming the identity of the enzyme responsible for the observed activity

  • Cellular lipid analysis: Cells expressing recombinant FA2H (such as transfected COS7 cells) show significantly elevated levels of 2-hydroxyceramides (C16, C18, C24, and C24:1) and 2-hydroxy fatty acids compared to control cells

  • Gas chromatography-mass spectrometry (GC-MS) or liquid chromatography-mass spectrometry (LC-MS): These analytical techniques can quantitatively measure the production of 2-hydroxy fatty acids in biological samples after extraction and derivatization

These complementary approaches provide convincing evidence of FA2H enzymatic activity and can be used to characterize the properties of recombinant mouse FA2H in various experimental systems.

How does FA2H contribute to myelination processes at the molecular level?

FA2H plays a critical role in myelination through its production of 2-hydroxylated fatty acids that become incorporated into myelin sphingolipids. At the molecular level, this process involves several steps:

  • FA2H hydroxylates free fatty acids at the C2 position in an NADPH-dependent reaction

  • These 2-hydroxy fatty acids are subsequently incorporated into ceramides during de novo sphingolipid synthesis

  • The resulting 2-hydroxy ceramides serve as precursors for the synthesis of 2-hydroxy galactosylceramides and sulfatides, which are major components of myelin

  • The presence of 2-hydroxy groups in these sphingolipids influences membrane properties, including fluidity, stability, and organization of lipid microdomains

  • These altered membrane properties contribute to the unique structural and functional characteristics of myelin, including its compact lamellar organization and insulating properties

During postnatal brain development in mice, the free 2-hydroxy fatty acid levels increase 5-9 fold from day 2 to day 30, coinciding with active myelination . The composition of these free 2-hydroxy fatty acids reflects the fatty acid composition of galactolipids, providing strong evidence for a precursor-product relationship . This molecular pathway demonstrates how FA2H enzymatic activity directly contributes to the unique lipid composition required for proper myelin formation and maintenance.

What are the consequences of FA2H deficiency in mouse models?

Studies of FA2H deficiency in mouse models have revealed several important phenotypes that highlight the enzyme's critical functions:

  • Myelin abnormalities: FA2H-deficient mice develop abnormal myelin structure with age, characterized by decreased stability and increased propensity for demyelination

  • Neurological deficits: As mice age, they progressively develop movement disorders, including ataxia and impaired motor coordination, reflecting the importance of FA2H in maintaining myelin integrity

  • Axonal degeneration: Long-term consequences of FA2H deficiency include axonal degeneration, particularly affecting long axonal tracts

  • Iron accumulation: Similar to human patients with FA2H mutations, FA2H-deficient mice may show abnormal iron accumulation in specific brain regions

  • Metabolic consequences: Beyond the nervous system, FA2H deficiency affects adipocyte differentiation and metabolism, with knockdown of FA2H inhibiting adipocyte differentiation of 3T3-L1 cells

These phenotypes closely resemble aspects of human disorders associated with FA2H mutations, such as fatty acid hydroxylase-associated neurodegeneration (FAHN) . The progressive nature of the deficits suggests that while FA2H is not essential for initial myelin formation, it is crucial for long-term myelin maintenance and stability, particularly during aging.

How does FA2H function in adipocyte differentiation and metabolism?

Recent research has revealed unexpected roles for FA2H in adipocyte biology, extending its functions beyond the nervous system:

  • Differentiation regulation: FA2H expression markedly increases during differentiation of 3T3-L1 preadipocytes into mature adipocytes, and small interfering RNAs against FA2H inhibit this differentiation process

  • Glucose metabolism: In mature adipocytes, depletion of FA2H inhibits both basal and insulin-stimulated glucose uptake, suggesting a role in glucose metabolism regulation

  • Lipogenesis: FA2H depletion inhibits lipogenesis in adipocytes, an effect that can be partially rescued by supplementation with 2-hydroxy palmitic acid, the enzymatic product of FA2H

  • Gene expression changes: FA2H knockdown leads to decreased expression of key metabolic enzymes including fatty acid synthase and stearoyl-CoA desaturase 1 (SCD1), as well as reduced levels of glucose transporter 4 (GLUT4) and insulin receptor proteins

  • Membrane raft modification: Since 2-hydroxy fatty acids are enriched in cellular sphingolipids that constitute membrane rafts, FA2H likely modulates raft fluidity and composition, thereby affecting the dynamics of raft-associated proteins like GLUT4

These findings establish FA2H as an important regulator of adipocyte function and suggest that its activity influences multiple aspects of cellular metabolism through effects on membrane structure and organization. The partial rescue of FA2H depletion phenotypes by 2-hydroxy palmitic acid confirms that these effects are at least partly dependent on the enzymatic activity of FA2H .

What expression systems are optimal for producing recombinant mouse FA2H?

Producing functional recombinant mouse FA2H requires careful consideration of expression systems that can support proper folding, post-translational modifications, and membrane insertion of this complex enzyme. Based on published research, the following systems have proven effective:

  • Mammalian expression systems:

    • COS7 cells have been successfully used to express functional human and mouse FA2H

    • These cells provide the appropriate cellular machinery for proper folding and membrane integration

    • Expression can be achieved using vectors like pcDNA3.1 with appropriate promoters (e.g., CMV)

    • Addition of epitope tags (His, FLAG, or HA) facilitates purification and detection

  • Insect cell expression systems:

    • Baculovirus-infected insect cells (Sf9, Hi5) can produce higher yields while maintaining proper folding

    • The system is particularly useful when larger amounts of protein are needed

    • Codon optimization for insect cell expression may improve yields

  • Considerations for functional expression:

    • Include the complete coding sequence with intact N-terminal cytochrome b5 domain, as this is essential for activity

    • Co-expression with NADPH:cytochrome P-450 reductase may enhance activity

    • For membrane integration studies, fluorescent protein fusions can be used

  • Purification approaches:

    • Detergent solubilization of membranes (e.g., with Triton X-100, DDM, or CHAPS)

    • Affinity chromatography using the added epitope tags

    • Size exclusion chromatography for final purification steps

When expressing FA2H in COS7 cells, significant increases (3-20 fold) in 2-hydroxyceramides and 2-hydroxy fatty acids can be detected compared to control cells, providing a convenient readout of enzymatic activity .

What are the critical parameters for optimizing FA2H activity assays?

Developing reliable and sensitive assays for FA2H activity requires optimization of several critical parameters:

  • Substrate selection and preparation:

    • Long-chain fatty acids (C16-C24) serve as preferred substrates

    • Substrates must be properly solubilized using detergents or cyclodextrins

    • Radioactively labeled or stable isotope-labeled substrates can enhance sensitivity

  • Reaction conditions:

    • Buffer composition: typically phosphate buffer (pH 7.4-7.6)

    • NADPH regenerating system: NADPH, glucose-6-phosphate, glucose-6-phosphate dehydrogenase

    • Addition of NADPH:cytochrome P-450 reductase enhances activity

    • Optimal temperature: 37°C for mammalian FA2H

    • Incubation time: typically 30-60 minutes (linearity should be verified)

  • Product analysis methods:

    • Lipid extraction procedures should be optimized for 2-hydroxy fatty acid recovery

    • Derivatization methods (e.g., methylation, trimethylsilylation) improve chromatographic properties

    • Gas chromatography-mass spectrometry (GC-MS) offers excellent sensitivity and specificity

    • Liquid chromatography-mass spectrometry (LC-MS) can analyze intact 2-hydroxy lipids

  • Controls and validation:

    • Negative controls: heat-inactivated enzyme, omission of essential cofactors

    • Antibody inhibition: anti-FA2H antibodies can confirm specificity

    • Enzyme concentration dependency: verify linearity with protein concentration

    • Substrate concentration studies: determine kinetic parameters (Km, Vmax)

When optimized properly, these assays can detect physiologically relevant changes in FA2H activity, such as the developmental increases observed during mouse brain myelination, where fatty acid 2-hydroxylase activity coincides with rising free 2-hydroxy fatty acid levels .

What techniques are effective for modulating FA2H expression in research models?

Several complementary techniques have proven effective for modulating FA2H expression in different research models:

  • Gene knockdown approaches:

    • Small interfering RNAs (siRNAs) have successfully depleted FA2H in 3T3-L1 adipocytes and other cell types

    • Short hairpin RNAs (shRNAs) delivered via lentiviral vectors can achieve stable long-term knockdown

    • Antisense oligonucleotides can provide an alternative approach for specific knockdown

  • Gene overexpression strategies:

    • Plasmid-based transient transfection with FA2H expression constructs

    • Viral vector systems (adenovirus, lentivirus) for more efficient delivery

    • Inducible expression systems (Tet-On/Off) for temporal control

  • Genome editing technologies:

    • CRISPR-Cas9 system for generating knockout cell lines or animal models

    • CRISPR activation (CRISPRa) or interference (CRISPRi) for modulating expression

    • Homology-directed repair for introducing specific mutations or tags

  • Functional rescue approaches:

    • Complementation with wild-type or mutant FA2H constructs in knockout systems

    • Addition of 2-hydroxy fatty acids to bypass the need for FA2H enzymatic activity

    • Structure-function studies using FA2H variants (e.g., cytochrome b5 domain deletions)

  • Transgenic mouse models:

    • Conventional knockout models to study systemic loss of FA2H

    • Conditional knockouts using Cre-loxP system for tissue-specific studies

    • Knock-in models to study specific mutations identified in human patients

These techniques have revealed important insights into FA2H function, such as the inhibition of adipocyte differentiation by FA2H knockdown and the partial rescue of metabolic defects by 2-hydroxy palmitic acid supplementation .

How can researchers effectively analyze changes in 2-hydroxy fatty acid profiles?

Comprehensive analysis of 2-hydroxy fatty acid profiles requires systematic approaches for accurate identification and quantification:

  • Sample preparation strategies:

    • Tissue or cell homogenization in appropriate solvents

    • Lipid extraction using optimized protocols (Bligh & Dyer, Folch)

    • Hydrolysis conditions to release 2-hydroxy fatty acids from complex lipids

    • Appropriate derivatization for analytical detection

  • Analytical methods and instrumentation:

    • Gas chromatography-mass spectrometry (GC-MS) with selective ion monitoring

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • High-resolution mass spectrometry for accurate mass determination

    • Use of internal standards for quantification (ideally isotopically labeled)

  • Data analysis approaches:

    • Measure both absolute and relative levels of 2-hydroxy fatty acids

    • Analyze chain length distribution patterns (C16-C24)

    • Calculate hydroxylation index (ratio of 2-hydroxy to non-hydroxy species)

    • Track developmental changes in composition profiles

  • Contextual interpretation:

    • Compare free 2-hydroxy fatty acids with those incorporated into sphingolipids

    • Correlate changes with FA2H expression levels and enzymatic activity

    • Consider tissue-specific differences in 2-hydroxy fatty acid profiles

    • Analyze precursor-product relationships as observed in mouse brain development

In mouse brain development studies, this approach revealed that free 2-hydroxy fatty acid levels increased 5-9 fold between 2 and 30 days of age, coinciding with FA2H upregulation and myelination . Furthermore, the composition of these free 2-hydroxy fatty acids was reflected in the fatty acids found in galactolipids, supporting a precursor-product relationship in the biosynthetic pathway .

What control experiments are essential when studying FA2H in different cellular contexts?

When investigating FA2H in various cellular contexts, several essential control experiments ensure robust and interpretable results:

  • Expression verification controls:

    • Quantitative PCR to confirm mRNA expression levels

    • Western blotting to verify protein expression and stability

    • Immunocytochemistry to confirm subcellular localization

    • Activity assays to validate functional enzyme production

  • Knockdown/knockout validation controls:

    • Measure residual mRNA and protein levels after FA2H depletion

    • Include non-targeting siRNA/shRNA controls

    • Perform rescue experiments with siRNA-resistant constructs

    • Test for off-target effects using multiple siRNA sequences

  • Substrate specificity controls:

    • Compare hydroxylation of different fatty acid chain lengths

    • Test dependency on cofactors (NADPH, NADPH:cytochrome P-450 reductase)

    • Include domain mutants (e.g., cytochrome b5 domain deletion)

    • Use anti-FA2H antibodies to confirm specific inhibition

  • Functional outcome controls:

    • Distinguish direct enzymatic effects from secondary consequences

    • Test rescue with 2-hydroxy fatty acids in FA2H-depleted systems

    • Use time-course studies to establish cause-effect relationships

    • Employ positive controls for phenotypic assays

  • Tissue/cell type-specific considerations:

    • Compare FA2H function across different cell types where it is expressed

    • Consider developmental timing, particularly for neuronal/glial studies

    • Account for differences in lipid composition between tissues

In studies of adipocyte differentiation, inclusion of 2-hydroxy palmitic acid partially rescued the effects of FA2H depletion, confirming that the observed phenotypes were specifically related to the loss of enzymatic products rather than secondary effects .

How can researchers determine the physiological significance of FA2H variants?

Assessing the physiological significance of FA2H variants requires a multi-faceted approach combining biochemical, cellular, and in vivo analyses:

  • Biochemical characterization:

    • Express recombinant variant proteins and measure enzymatic activity

    • Determine alterations in substrate specificity or kinetic parameters

    • Assess protein stability and subcellular localization

    • Evaluate interactions with cofactors and other proteins

  • Structural analysis:

    • Map variants to functional domains (e.g., cytochrome b5 domain, transmembrane regions)

    • Predict effects on protein folding and stability using computational tools

    • Consider conservation of affected residues across species

  • Cellular phenotyping:

    • Examine effects on 2-hydroxy sphingolipid production

    • Assess functional outcomes in relevant cell types (oligodendrocytes, adipocytes)

    • Test dominant-negative effects when co-expressed with wild-type protein

    • Measure membrane properties in cells expressing variant proteins

  • Clinical correlation:

    • Compare genetic variants with clinical presentations in patients

    • Classify variants using established criteria (pathogenic, likely pathogenic, etc.)

    • Consider genotype-phenotype correlations across different mutations

    • Document in appropriate databases like the Global Variome shared LOVD

  • In vivo modeling:

    • Generate knock-in mouse models for specific variants

    • Assess phenotypic consequences including myelin structure and function

    • Measure iron accumulation in brain regions as observed in human patients

    • Test therapeutic interventions targeting specific defects

The Global Variome shared LOVD database contains information on FA2H variants, including the pathogenic c.21del variant that results in a frameshift (p.Ala8Profs*91) . Systematic characterization of such variants provides insights into structure-function relationships and improves genetic counseling for affected families.

What emerging techniques could advance our understanding of FA2H function?

Several cutting-edge techniques hold promise for deepening our understanding of FA2H biology:

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize FA2H localization within membrane microdomains

    • Live-cell imaging with fluorescent lipid probes to track 2-hydroxy sphingolipid dynamics

    • Correlative light and electron microscopy to link FA2H distribution with membrane ultrastructure

    • Proximity labeling techniques to identify proteins in close association with FA2H

  • Comprehensive lipidomics:

    • High-throughput mass spectrometry for detailed profiling of all 2-hydroxy lipid species

    • Spatial lipidomics to map 2-hydroxy sphingolipid distribution within tissues and cells

    • Stable isotope labeling to track metabolic flux through the 2-hydroxylation pathway

    • Single-cell lipidomics to capture cellular heterogeneity in 2-hydroxy lipid composition

  • Systems biology integration:

    • Multi-omics approaches combining lipidomics, proteomics, and transcriptomics

    • Network analysis to identify regulatory pathways controlling FA2H expression

    • Mathematical modeling of membrane biophysics incorporating 2-hydroxy sphingolipids

    • Artificial intelligence tools to predict functional consequences of FA2H variants

  • Innovative genetic tools:

    • Inducible and reversible gene modulation systems for temporal control

    • Cell type-specific CRISPR genome editing in vivo

    • Base editing or prime editing for precise introduction of specific mutations

    • Synthetic biology approaches to engineer FA2H with novel properties

These emerging techniques will help address critical questions about FA2H function, including its role in membrane organization, interactions with other proteins, and contributions to cellular signaling pathways in both normal physiology and disease states.

What are the potential therapeutic applications targeting FA2H or its enzymatic products?

Research on FA2H has revealed several promising therapeutic applications:

  • For FA2H-associated neurological disorders:

    • Gene therapy approaches to restore functional FA2H expression

    • Small molecule modulators to enhance residual FA2H activity in patients with hypomorphic mutations

    • Substrate reduction therapy to address potential toxic accumulation of intermediates

    • Delivery of 2-hydroxy fatty acids or their precursors as substrate replacement therapy

  • For demyelinating disorders:

    • Modulation of FA2H activity to enhance remyelination processes

    • Targeting iron accumulation mechanisms that contribute to neurodegeneration in FAHN patients

    • Combined approaches addressing multiple aspects of myelin lipid composition

  • For metabolic disorders:

    • Targeting adipocyte FA2H to modulate insulin sensitivity and glucose uptake

    • Exploring the role of 2-hydroxy sphingolipids in membrane raft function and signaling

    • Developing 2-hydroxy lipid-based compounds as potential therapeutic agents

  • Biomarker development:

    • Measuring 2-hydroxy sphingolipids in cerebrospinal fluid as biomarkers of FA2H-associated disorders

    • Using lipid profiles to monitor disease progression or treatment response

    • Developing imaging approaches to visualize 2-hydroxy sphingolipid distribution in vivo

These therapeutic directions require further research to understand the detailed mechanisms by which FA2H and its products influence cellular functions. The partial rescue of FA2H depletion effects by 2-hydroxy palmitic acid in adipocytes provides proof-of-concept for substrate replacement approaches .

How might FA2H research inform our broader understanding of membrane biology?

FA2H research has broader implications for fundamental concepts in membrane biology:

  • Membrane microdomain organization:

    • 2-Hydroxy sphingolipids likely influence lipid raft structure and dynamics

    • Research on FA2H can illuminate how specific lipid modifications affect membrane properties

    • Studies in adipocytes suggest FA2H modulates raft fluidity and protein distribution

  • Protein-lipid interactions:

    • The hydroxyl group at C2 position may form hydrogen bonds with membrane proteins

    • Understanding how 2-hydroxy sphingolipids interact with specific proteins could reveal new principles of membrane protein regulation

    • GLUT4 trafficking and insulin receptor function in adipocytes demonstrate functional consequences of these interactions

  • Membrane adaptation mechanisms:

    • Changes in FA2H activity during development suggest roles in adaptive membrane remodeling

    • The dramatic increase in 2-hydroxy galactolipids during myelination illustrates how membranes are specialized for specific functions

    • Comparative studies across tissues with different FA2H expression levels can reveal tissue-specific membrane adaptations

  • Evolutionary perspectives:

    • Conservation of FA2H from yeast to humans suggests fundamental roles in eukaryotic membranes

    • The human FA2H gene shows homology to the yeast ceramide 2-hydroxylase gene (FAH1)

    • Comparing 2-hydroxy sphingolipid functions across species may reveal evolutionary adaptations in membrane biology

By studying the specific roles of FA2H and 2-hydroxy sphingolipids in various cellular contexts, researchers can gain insights into general principles governing membrane organization, dynamics, and function. These principles have implications beyond FA2H biology, potentially informing our understanding of membrane-associated processes in diverse physiological and pathological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.