Recombinant Mouse Fatty acid desaturase 1 (Fads1)

Shipped with Ice Packs
In Stock

Description

Functional Role

Fads1 is a delta-5 desaturase critical for converting dihomo-γ-linolenic acid (DGLA; 20:3n-6) and eicosatetraenoic acid (ETA; 20:4n-3) into arachidonic acid (AA; 20:4n-6) and eicosapentaenoic acid (EPA; 20:5n-3), respectively . These products are precursors for signaling molecules (e.g., prostaglandins, leukotrienes) and structural components of cell membranes. Key functional insights include:

  • Lipid Metabolism Regulation: Modulates phosphatidylinositol-4,5-bisphosphate levels, influencing inflammatory cytokine production .

  • Membrane Fluidity: Controls phospholipid composition, affecting membrane protein function and cellular plasticity .

Production and Purification

Recombinant Mouse Fads1 is typically produced using in vitro expression systems. While specific host systems are not explicitly detailed in available data, common platforms for recombinant protein production (e.g., Escherichia coli, wheat germ, or mammalian cells) are inferred . Critical production parameters include:

ParameterDetail
Expression RegionFull-length (amino acids 1-447)
TagDetermined during production (commonly GST or His tags for purification)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C for short-term; -80°C for long-term stability

Research Applications

Recombinant Mouse Fads1 is widely used in biochemical and functional studies, including:

  1. Enzyme Activity Assays: Quantifying desaturase activity using radiolabeled substrates or mass spectrometry .

  2. Structural Studies: Analyzing membrane-associated domains via cryo-EM or X-ray crystallography.

  3. Antibody Production: Serving as an antigen for generating isoform-specific antibodies .

  4. Lipidomics: Investigating HUFA biosynthesis pathways in transgenic mouse models .

Key Considerations for Use

  • Stability: Avoid repeated freeze-thaw cycles; aliquot working stocks stored at 4°C for ≤1 week .

  • Activity Validation: Confirm catalytic function using control substrates (e.g., DGLA or ETA) .

Future Directions

While current studies focus on Fads1’s metabolic roles, emerging research highlights its potential in cancer biology and inflammatory diseases . Recombinant Mouse Fads1 will remain pivotal for dissecting tissue-specific lipid remodeling mechanisms and developing targeted therapies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Fads1; Acyl-CoA; 8-3-desaturase; Delta(5 fatty acid desaturase; D5D; Delta(5 desaturase; Delta-5 desaturase; Fatty acid desaturase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-447
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fads1
Target Protein Sequence
MAPDPVPTPGPASAQLRQTRYFTWEEVAQRSGREKERWLVIDRKVYNISDFSRRHPGGSR VISHYAGQDATDPFVAFHINKGLVRKYMNSLLIGELAPEQPSFEPTKNKALTDEFRELRA TVERMGLMKANHLFFLVYLLHILLLDVAAWLTLWIFGTSLVPFILCAVLLSTVQAQAGWL QHDFGHLSVFGTSTWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNCFRKDPDINMHPL FFALGKVLPVELGREKKKHMPYNHQHKYFFLIGPPALLPLYFQWYIFYFVVQRKKWVDLA WMLSFYARIFFTYMPLLGLKGFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNVDWVS TQLQATCNVHQSAFNNWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKYGIKYESK PLLTAFADIVYSLKESGQLWLDAYLHQ
Uniprot No.

Target Background

Function
Fatty acid desaturase 1 (FADS1) acts as a front-end fatty acyl-coenzyme A (CoA) desaturase. It introduces a cis double bond at carbon 5, located between a preexisting double bond and the carboxyl end of the fatty acyl chain. FADS1 is involved in the biosynthesis of highly unsaturated fatty acids (HUFA) from essential polyunsaturated fatty acids (PUFA) precursors, including linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Specifically, it desaturates dihomo-gamma-linoleoate (DGLA) (20:3n-6) and eicosatetraenoate (ETA) (20:4n-3) to generate arachidonate (AA) (20:4n-6) and eicosapentaenoate (EPA) (20:5n-3), respectively. As a rate-limiting enzyme for DGLA (20:3n-6) and AA (20:4n-6)-derived eicosanoid biosynthesis, FADS1 controls the metabolism of inflammatory lipids like prostaglandin E2, essential for efficient acute inflammatory response and maintaining epithelial homeostasis. It contributes to membrane phospholipid biosynthesis by providing AA (20:4n-6) as a major acyl chain esterified into phospholipids. Notably, FADS1 regulates phosphatidylinositol-4,5-bisphosphate levels, modulating inflammatory cytokine production in T-cells. Additionally, it desaturates (11E)-octadecenoate (trans-vaccenoate)(18:1n-9), a metabolite in the biohydrogenation pathway of LA (18:2n-6).
Gene References Into Functions
  1. Data (including data from studies using knockout mice) suggest that increased dietary intake of EPA (eicosapentaenoic acid) and DHA (docosahexaenoic acid) differentially affects the activity of D5D/Fads1 and D6D/Fads2 in specific tissues. PMID: 28697636
  2. Differential PUFA profiles between HET mice and human FADS SNPs suggest low expression of both FADS1 and 2 genes in human minor haplotypes. PMID: 27613800
  3. Data indicate that delta-5 desaturase (D5D) inhibition was confirmed by determining changes in blood arachidonic acid/dihomo-gamma-linolenic acid (AA/DGLA) profiles. PMID: 27832159
  4. The Systemic disruption of the Fads1 gene reciprocally altered the levels of dihomo-gamma-linolenic acid and AA in mouse tissues, resulting in a profound increase in 1-series-derived and a concurrent decrease in 2-series-derived prostaglandins. PMID: 22534642
  5. Analysis of mRNA abundance and expression of SLC27A, ACC, SCD, FADS, LPIN, INSIG, and PPARGC1 gene isoforms in mouse mammary glands during the lactation cycle PMID: 20603810
  6. Support a significant role for reverse Delta5-desaturase as a natural antisense regulator of Delta5-desaturase PMID: 16846730
  7. n-3 fatty acid desaturase may have a role in colitis-associated colon cancer in mice PMID: 18483285

Show More

Hide All

Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion.
Tissue Specificity
Highly expressed in the adrenal gland, liver, brain, and testis, tissues where lipogenesis and steroidogenesis are active. Expressed in colonic mucosa.

Q&A

What is the functional role of FADS1 in lipid metabolism?

FADS1, also known as delta-5 desaturase (D5D), is a rate-limiting enzyme in the biosynthesis pathway of long-chain polyunsaturated fatty acids (LC-PUFAs). It catalyzes the desaturation of dihomo-gamma-linoleic acid (DHGLA) (20:3n-6) to generate arachidonic acid (AA) (20:4n-6) and converts eicosatetraenoic acid (20:4n-3) to eicosapentaenoic acid (EPA) (20:5n-3) . This enzyme plays a critical role in the metabolic pathway that transforms essential polyunsaturated fatty acids (PUFAs) like linoleic acid (18:2n-6) and alpha-linolenic acid (18:3n-3) into their biologically active highly unsaturated fatty acid derivatives .

What are the key molecular and cellular processes influenced by FADS1 activity?

FADS1 influences multiple biological processes including:

  • Cellular response to starvation

  • Icosanoid biosynthetic process

  • Linoleic acid metabolic process

  • Phospholipid biosynthetic process

  • Unsaturated fatty acid biosynthetic process

These processes are critical for maintaining cell membrane fluidity, inflammatory signaling, and energy homeostasis. In research contexts, modulating FADS1 activity can directly impact these pathways, making it important to consider downstream effects when designing experiments.

What expression systems are optimal for producing functional recombinant mouse FADS1?

Multiple expression systems can be used for producing recombinant mouse FADS1, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesDisadvantagesTypical YieldRecommended Applications
E. coliCost-effective, high yield, rapid productionMay lack proper folding and post-translational modifications0.5-1 mg/L cultureStructural studies, antibody production
BaculovirusBetter post-translational modifications than bacterial systemsModerate cost, more complex procedure0.05-0.1 mg/L cultureFunctional studies requiring proper folding
YeastGood compromise between bacterial and mammalian systemsMedium cost, moderate yield0.5-1 mg/L cultureEnzymatic assays, protein-protein interaction studies
Mammalian cellMost authentic post-translational modificationsHighest cost, lowest yield, time-consuming0.05-0.1 mg/L cultureStudies requiring native enzyme activity and regulation

For functional studies requiring proper membrane insertion and post-translational modifications, mammalian or insect cell expression systems are recommended despite their higher cost and lower yield .

What purification strategies are most effective for obtaining highly pure and active recombinant mouse FADS1?

Since FADS1 is an integral membrane protein, specialized purification strategies are required:

  • Initial extraction using mild detergents (n-dodecyl β-D-maltoside or CHAPS) to solubilize the protein from membrane fractions

  • Affinity chromatography using engineered tags (His, FLAG, or GST)

  • Size exclusion chromatography to separate the purified protein from aggregates

  • Optional ion exchange chromatography step for higher purity

For enzymatic assays, detergent-solubilized protein typically retains activity, but for structural studies, reconstitution into lipid nanodiscs or liposomes may be necessary to maintain native conformation and activity.

How can I measure the enzymatic activity of recombinant mouse FADS1 in vitro?

The enzymatic activity of recombinant FADS1 can be measured using several complementary approaches:

  • Gas Chromatography (GC) based assays: Measure the conversion of substrate fatty acids (e.g., DHGLA) to product fatty acids (e.g., AA) after incubation with purified FADS1, NADH, cytochrome b5, and cytochrome b5 reductase.

  • LC-MS/MS approaches: Quantify substrate depletion and product formation with higher sensitivity and specificity than GC methods.

  • Isotope-labeled substrate assays: Use deuterium or 13C-labeled substrates to track conversion rates more precisely.

  • Oxygen consumption assays: Since FADS1 is an oxidoreductase that introduces a double bond (requiring oxygen), oxygen consumption rate can be measured as a proxy for activity.

When measuring activity, it's crucial to provide appropriate electron transport components (cytochrome b5 and cytochrome b5 reductase) as FADS1 requires these for function.

How can I distinguish between FADS1 and FADS2 activities when analyzing fatty acid profiles?

Distinguishing between FADS1 and FADS2 activities requires careful experimental design and analysis, as these enzymes have related but distinct functions in the PUFA biosynthesis pathway:

  • Substrate/product specificity: FADS1 (Δ5-desaturase) catalyzes the conversion of DHGLA (20:3n-6) to AA (20:4n-6), while FADS2 (Δ6-desaturase) catalyzes the conversion of linoleic acid (18:2n-6) to γ-linolenic acid (18:3n-6).

  • Activity ratios: Calculate product-to-substrate ratios to estimate enzyme activity:

    • FADS1 activity ratio: AA/DHGLA (20:4n-6/20:3n-6)

    • FADS2 activity ratio: GLA/LA (18:3n-6/18:2n-6)

  • Selective inhibition: Use selective inhibitors like D5D-IN-326 for FADS1 to differentiate the contribution of each enzyme.

  • Gene expression analysis: Measure mRNA levels of both enzymes to correlate with observed activities, noting that FADS1 and FADS2 mRNA levels are often highly correlated (p=1.2×10−48) .

What genetic polymorphisms in mouse FADS1 should I consider when interpreting research data?

Several genetic polymorphisms can affect FADS1 expression and activity in mice, potentially confounding research results:

  • cis-regulatory SNPs: Several single nucleotide polymorphisms in the LD block act as cis-regulators for FADS1 gene transcription .

  • Strain differences: Different mouse strains exhibit variable FADS1 expression levels and activity, which should be considered when comparing results across studies.

  • Interaction with FADS2: FADS1 and FADS2 expression levels are highly correlated, suggesting shared regulatory mechanisms . Polymorphisms affecting one gene may influence the other.

When designing mouse experiments, researchers should consider genotyping for relevant FADS1 variants or using genetically defined strains to minimize variability. For translational research, humanized FADS1 mouse models may provide more relevant insights into human disease mechanisms.

How does FADS1 expression correlate with downstream metabolic markers in different experimental contexts?

FADS1 expression levels correlate with multiple downstream metabolic markers:

  • Fatty acid ratios: FADS1 expression positively correlates with AA/DHGLA and EPA/ETA ratios, reflecting its enzymatic activity.

  • Inflammatory markers: Higher FADS1 activity often correlates with increased production of pro-inflammatory eicosanoids derived from arachidonic acid.

  • Cholesterol metabolism: FADS1 expression is associated with genes involved in cholesterol biosynthesis pathways .

  • Cell cycle regulation: Pathway analysis demonstrates that FADS1 is associated with cell cycle control genes .

These correlations vary by tissue type and experimental conditions. Researchers should measure multiple markers concurrently to establish context-specific relationships.

How can recombinant mouse FADS1 be utilized in cancer research models?

Recombinant mouse FADS1 has several valuable applications in cancer research:

  • Biomarker development: FADS1 expression serves as a predictor for cancer survival in multiple cancer types, with differential effects observed between brain and non-brain cancers .

  • Drug target validation: Pharmacological inhibition of FADS1 reduces cancer cell proliferation in certain cancer types, suggesting potential therapeutic applications .

  • Patient stratification models: FADS1 genotypes can be used to develop patient stratification models for personalized medicine approaches .

  • Tumor microenvironment studies: FADS1 expression correlates with fibroblast and macrophage infiltration signatures, indicating potential roles in modeling the tumor microenvironment .

How does FADS1 function differ between normal and pathological states?

FADS1 exhibits significant functional differences between normal and pathological states:

  • Expression level differences: FADS1 expression is significantly increased in primary tumors compared to normal tissues, with even higher expression in metastatic or recurrent tumors in most cancer types .

  • Relationship with tumor suppressors: FADS1 expression is higher when TP53 is mutated, suggesting a potential functional relationship with tumor suppressor pathways .

  • Pathway associations: In pathological states, FADS1 shows stronger associations with cell cycle control pathways, including "Role of BRCA1 in DNA damage response," "kinetochore metaphase signaling," and "cell cycle control of chromosomal replication" .

  • Tissue-specific effects: Brain cancers show a distinct pattern where FADS1 expression is lower in recurrent tumors compared to primary tumors, contrasting with the pattern observed in non-brain cancers .

What methods can be employed to study FADS1-protein interactions in complex cellular systems?

Several advanced methods can be used to study FADS1-protein interactions:

  • Proximity labeling approaches: BioID or APEX2 fusion proteins to identify proteins in close proximity to FADS1 in living cells.

  • Co-immunoprecipitation with mass spectrometry: To identify stable interaction partners of FADS1.

  • FRET/BRET assays: To study dynamic interactions between FADS1 and suspected binding partners.

  • Membrane yeast two-hybrid systems: Specialized for identifying interactions involving membrane proteins like FADS1.

  • Crosslinking mass spectrometry: To capture transient interactions that might be missed by standard approaches.

When designing interaction studies, researchers should consider:

  • FADS1's membrane localization in the endoplasmic reticulum

  • The potential role of lipid cofactors in mediating interactions

  • The need for proper detergents to maintain protein stability during extraction

How can I develop and validate FADS1 inhibitors for experimental applications?

A systematic approach to developing and validating FADS1 inhibitors includes:

  • Initial screening approaches:

    • In silico docking against FADS1 structural models

    • High-throughput biochemical assays measuring desaturase activity

    • Cell-based fatty acid composition analyses

  • Validation parameters:

    • Selectivity testing against other desaturases (especially FADS2)

    • Dose-response relationships in enzymatic and cellular assays

    • Effects on fatty acid profiles (decreased AA/DHGLA ratio)

    • Binding studies with purified protein

  • Cellular validation:

    • Comparison with genetic knockdown/knockout

    • Rescue experiments with AA supplementation

    • Effects on downstream pathways

The compound D5D-IN-326 has been identified as a FADS1 inhibitor with demonstrated effects on cancer cell proliferation, providing a starting point for developing experimental tools .

What are common pitfalls when working with recombinant FADS1 and how can they be addressed?

Several challenges are commonly encountered when working with recombinant FADS1:

  • Low expression levels: As a membrane protein, FADS1 often expresses poorly in heterologous systems.

    • Solution: Optimize codon usage, use specialized host strains, and consider fusion tags that enhance expression.

  • Protein aggregation: FADS1 can form aggregates during purification.

    • Solution: Use mild detergents, optimize buffer conditions, and consider nanodiscs for stabilization.

  • Loss of activity during purification: Enzymatic activity can be compromised by harsh purification conditions.

    • Solution: Develop gentle purification protocols, maintain reducing conditions, and validate activity at each step.

  • Confounding effects of endogenous FADS1: Host cell FADS1 may interfere with activity measurements.

    • Solution: Use FADS1-knockout cell lines or include appropriate controls to distinguish recombinant from endogenous activity.

  • Reagent contamination: Commercial fatty acid substrates may contain trace amounts of products.

    • Solution: Verify substrate purity by GC-MS before use and include zero-time controls.

How can I address data inconsistencies when comparing different FADS1 activity assays?

When comparing data across different FADS1 activity assays, researchers often encounter inconsistencies due to methodological differences. To address these:

  • Standardize reaction conditions: Temperature, pH, cofactor concentrations, and substrate presentations all affect FADS1 activity. Adopt consistent conditions across experiments.

  • Account for substrate accessibility: The presentation of fatty acid substrates (free fatty acids vs. CoA esters) significantly affects measured activity. Compare only assays using the same substrate form.

  • Consider complementary approaches: Use both direct product formation and substrate depletion measurements to confirm activity.

  • Establish internal controls: Include a reference FADS1 preparation with known activity in each assay to enable normalization across experiments.

  • Address matrix effects: Components in biological samples may enhance or inhibit FADS1 activity. Include matrix-matched calibration curves.

By implementing these strategies, researchers can achieve more consistent and comparable results across different experimental approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.