Recombinant Mouse Fatty acid desaturase 2 (Fads2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
Fads2; Fadsd2; Acyl-CoA 6-desaturase; Delta(6 fatty acid desaturase; D6D; Delta(6 desaturase; Delta-6 desaturase; Fatty acid desaturase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGKGGNQGEGSTERQAPMPTFRWEEIQKHNLRTDRWLVIDRKVYNVTKWSQRHPGGHRVI GHYSGEDATDAFRAFHLDLDFVGKFLKPLLIGELAPEEPSLDRGKSSQITEDFRALKKTA EDMNLFKTNHLFFFLLLSHIIVMESLAWFILSYFGTGWIPTLVTAFVLATSQAQAGWLQH DYGHLSVYKKSIWNHVVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDIKSLHVFV LGEWQPLEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMISRRDWVDLAWAI SYYMRFFYTYIPFYGILGALVFLNFIRFLESHWFVWVTQMNHLVMEIDLDHYRDWFSSQL AATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALIDIVSSLKKSGELWLDAYLHK
Uniprot No.

Target Background

Function
FADS2 plays a crucial role in the biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors. It acts as a fatty acyl-coenzyme A (CoA) desaturase, introducing a cis double bond at carbon 6 of the fatty acyl chain. FADS2 catalyzes the initial and rate-limiting step in this pathway, converting LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively. Further along the biosynthetic pathway of HUFA n-3 series, FADS2 desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is then converted to docosahexaenoate (DHA)(22:6n-3), an essential lipid for nervous system function. FADS2 can also desaturate (11E)-octadecenoate (trans-vaccenoate) at carbon 6, generating (6Z,11E)-octadecadienoate. In addition to Delta-6 activity, this enzyme exhibits Delta-8 activity with slight biases toward n-3 fatty acyl-CoA substrates.
Gene References Into Functions
  1. Data (including data from knockout mouse studies) indicate that increased dietary intake of EPA (eicosapentaenoic acid) and DHA (docosahexaenoic acid) differentially affects the activity of D5D/Fads1 and D6D/Fads2 in specific tissues. PMID: 28697636
  2. In contrast, Fads2-/- and WT mice fed an atherogenic diet showed minimal differences in n-6 PUFA content in serum and white adipose tissue (WAT), despite having significantly more AA than control diet-fed mice. No differences in gene expression for common inflammatory adipokines (e.g., Mcp-1, Ccl5, Tnfalpha) or key regulators of eicosanoid production (e.g., Cox-2, Alox-12, Alox-15) were detected in WAT between any of the diet and genotype groups. PMID: 29031400
  3. In a recent study, significant hepatic lipid accumulation was observed in essential fatty acid deficiency (EFAD) mice treated with a FADS2 inhibitor. FADS2 inhibition in the EFAD state reduced very low-density lipoprotein (VLDL) secretion and markedly diminished Mead acid in phosphatidylcholine (PC) in the liver and plasma. PMID: 29353041
  4. Evidence suggests that the immunomodulatory effects of dietary omega-6 vs. omega-3 fatty acids are partially attributed to the interconversion of various consumed/administered unsaturated fatty acids. Consequently, delta-6 desaturase plays a role in the immunomodulatory effects of dietary unsaturated fatty acids. PMID: 27142734
  5. Using a sample of 534 twins, a study observed a trend in the moderation of brain fatty acid effects on IQ by FADS2 variation. Analysis of publicly available gene expression databases from both humans and mice revealed that FADS2 variants also correlate with FADS1 brain expression. PMID: 23826354
  6. Differential PUFA profiles between heterozygous mice and human FADS SNPs suggest low expression of both FADS1 and FADS2 genes in human minor haplotypes. PMID: 27613800
  7. FADS2 deficient mice exhibit resistance to obesity. PMID: 24378641
  8. Knockdown of Elovl5, Fads1, or Fads2 reduced the level of Mead acid. PMID: 24184513
  9. D6D activity is upregulated during melanoma and lung tumor growth. Suppressing D6D activity, either by RNAi knockdown or a specific D6D inhibitor, significantly reduces tumor growth. PMID: 23112819
  10. Results suggest that FADS2 is essential for spermatogenesis. Fads2-/- knockout mice develop docosahexaenoic acid deficiency, and acrosome biogenesis is halted after the release of proacrosomal granules. PMID: 21653892
  11. Analysis of macrophage cholesterol biosynthesis and decreased cellular paraoxonase 2 (PON2) expression in Delta6-desaturase knockout (6-DS KO) mice. PMID: 20042190
  12. The creation of D6D-null mice (-/-) allowed researchers to study highly unsaturated fatty acid deficiency without depleting their precursors. PMID: 19351970
  13. Methylation silencing of liver Fads2 expression and changes in liver fatty acids may contribute to the pathology of hyperhomocysteinemia. PMID: 17971455
  14. Conjugated linoleic acid-induced fat loss was found to be dependent on delta6-desaturase activity. PMID: 18719641
  15. Deletion of delta6-fatty acid desaturase (FADS2) gene expression abolishes the initial step in the enzymatic cascade of PUFA synthesis. PMID: 19172737

Show More

Hide All

Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the adrenal gland, liver, brain, and testis, tissues where lipogenesis and steroidogenesis are active. Also detected in lung, heart, and skeletal muscle.

Q&A

What is the molecular structure of Mouse Fads2 and how does it influence function?

Mouse Fatty acid desaturase 2 (Fads2) is an endoplasmic reticulum membrane-bound protein with a distinctive structure featuring a cytochrome b5-like domain on the N-terminus and a main desaturation domain containing three histidine-rich regions on the C-terminus. This structural organization enables the protein to function as the first rate-limiting enzyme in long-chain polyunsaturated fatty acid (LC-PUFA) biosynthesis. The fusion of the cytochrome b5-like domain to the main desaturase domain facilitates direct electron transfer from NADH cytochrome b5 reductase to the catalytic site via the cytochrome b5-like domain, though an independent cytochrome b5 is still required for complete functionality .

The three histidine-rich regions within the desaturation domain are highly conserved evolutionary features that coordinate two iron atoms at the active site. These histidine residues are positioned in close proximity to the fatty acid substrate and are referred to as "contact residues," playing a critical role in substrate binding and catalytic activity . The structural characteristics of Fads2 make it a challenging protein to characterize through conventional biochemical methods, and notably, a three-dimensional structure by X-ray crystallography has not yet been determined.

How does Fads2 contribute to polyunsaturated fatty acid biosynthesis in mouse models?

Fads2 plays a pivotal role in polyunsaturated fatty acid biosynthesis by introducing a double bond at the δ6 position of the fatty acid chain. This enzymatic action represents the initial and rate-limiting step in the conversion pathway of essential fatty acids to their longer-chain derivatives . In mouse models, Fads2 primarily catalyzes the desaturation of linoleic acid (18:2n-6) and α-linolenic acid (18:3n-3) to produce γ-linolenic acid and stearidonic acid, respectively, which are then further elongated and desaturated to form arachidonic acid (AA), eicosapentaenoic acid (EPA), and docosahexaenoic acid (DHA) .

The biosynthetic capacity provided by Fads2 is particularly significant in contexts where dietary intake of LC-PUFAs is insufficient. Alterations in Fads2 activity directly influence the endogenous production of these biomolecules, which has substantial implications for cellular membrane composition, inflammatory responses, and signaling pathway function in various tissue types .

What are the optimal methods for measuring Fads2 activity in experimental settings?

For accurate assessment of Fads2 activity in experimental settings, researchers have developed several complementary approaches:

  • Enzyme Activity Assays: Direct measurement of desaturase activity can be achieved by incubating recombinant Fads2 or cellular microsomes with radiolabeled fatty acid substrates, followed by thin-layer chromatography or gas chromatography to quantify the conversion of substrate to product. The rate of incorporation of deuterium or other stable isotopes into fatty acids can also be measured using mass spectrometry to determine desaturation activity.

  • ELISA-Based Quantification: For protein level quantification, sandwich ELISA methods provide reliable detection of Fads2 in mouse serum, plasma, and cell culture supernatants. The Mouse Fatty Acid Desaturase 2 ELISA Kit employs high-sensitivity antibodies specific to mouse Fads2, allowing for accurate measurement across a wide range of concentrations .

  • Fatty Acid Profiling: Comprehensive analysis of cellular or tissue fatty acid composition using gas chromatography-mass spectrometry (GC-MS) can serve as an indirect indicator of Fads2 activity. Specific product-to-substrate ratios (e.g., 18:3n-6/18:2n-6) are often used as surrogate markers of Fads2 function.

  • Gene Expression Analysis: Quantitative PCR, RNA sequencing, or protein immunoblotting can be employed to assess Fads2 expression levels, which often correlate with enzymatic activity in many experimental contexts.

What strategies can be employed to express and purify recombinant Mouse Fads2?

Expressing and purifying recombinant Mouse Fads2 presents significant challenges due to its hydrophobic, membrane-bound nature. Successful strategies include:

  • Expression Systems:

    • Bacterial systems (E. coli): While cost-effective, they often result in inclusion bodies requiring refolding protocols that may compromise activity.

    • Yeast systems (S. cerevisiae, P. pastoris): Provide eukaryotic post-translational modifications and membrane integration capabilities, improving the likelihood of obtaining functional protein.

    • Insect cell systems (Sf9, High Five): Offer superior eukaryotic processing for membrane proteins and have been successfully used for related desaturases.

    • Mammalian cell systems (HEK293, CHO): Provide the most native-like environment but at higher cost and lower yield.

  • Purification Approach:

    • Detergent solubilization: Critical for extracting Fads2 from membranes, with mild non-ionic detergents (DDM, LMNG) generally preserving activity better than harsher ionic detergents.

    • Affinity chromatography: Addition of tags (His, FLAG, Strep) facilitates purification, with C-terminal tags often preferred to avoid interfering with the N-terminal cytochrome b5-like domain.

    • Size exclusion chromatography: Essential for removing aggregates and ensuring protein homogeneity.

  • Stability Enhancement:

    • Lipid supplementation during purification to maintain native-like membrane environment

    • Addition of stabilizing agents such as glycerol or specific substrate analogs

    • Use of nanodiscs or liposomes for reconstitution of purified protein

How do polymorphisms in the Fads2 gene influence metabolic phenotypes in research models?

Fads2 gene polymorphisms significantly impact metabolic phenotypes in research models through alterations in enzyme activity and subsequent changes in fatty acid metabolism. Studies have identified several key single nucleotide polymorphisms (SNPs) that modify Fads2 function with downstream physiological consequences:

The rs174583 polymorphism in the FADS2 gene has been associated with variations in waist-to-hip ratio (WHR) and other anthropometric measures in research subjects, indicating its influence on body fat distribution and metabolic health . This genetic variation appears to interact with dietary factors, suggesting that Fads2 polymorphisms may contribute to differential responses to nutritional interventions.

Research has demonstrated that FADS2 genetic variations not only affect lipid metabolism but also influence broader physiological processes. Studies examining the rs174575 polymorphism revealed potential interactions with breastfeeding and cognitive development, highlighting the far-reaching implications of Fads2 genetic variation beyond direct metabolic effects .

The functional consequences of these polymorphisms likely stem from alterations in enzyme efficiency, substrate specificity, or expression levels, which collectively modify the LC-PUFA biosynthetic capacity. These genetic variations provide valuable models for understanding how subtle changes in fatty acid metabolism influence systemic physiological processes.

What techniques are most effective for studying Fads2 gene function in mouse models?

Several complementary techniques have proven effective for investigating Fads2 gene function in mouse models:

  • Gene Knockout and Knockdown Approaches:

    • Conventional gene knockout: Complete deletion of Fads2 provides insights into essential functions but may be limited by developmental consequences

    • Conditional knockout: Tissue-specific or inducible Fads2 deletion using Cre-loxP systems enables temporal and spatial control

    • RNAi and shRNA: Partial knockdown allows dose-dependent analysis of Fads2 reduction

    • CRISPR/Cas9: Precise gene editing to introduce specific mutations or polymorphisms found in human populations

  • Functional Genomics:

    • RNA-Seq analysis to identify transcriptional networks affected by Fads2 modulation

    • ChIP-Seq to determine transcription factor binding and regulatory elements controlling Fads2 expression

    • Proteomics approaches to characterize protein-protein interactions with Fads2

  • Metabolic Phenotyping:

    • Lipidomics analysis of tissue and plasma to comprehensively profile fatty acid composition

    • Metabolic flux analysis using stable isotope-labeled fatty acids to track conversion rates

    • Integration of physiological measurements (glucose tolerance, insulin sensitivity) with Fads2 activity

  • Imaging Techniques:

    • Subcellular localization studies using fluorescent protein fusions or immunofluorescence

    • Live-cell imaging to track dynamics of fatty acid metabolism in real-time

How does Fads2 activity contribute to cancer progression in experimental models?

Fads2 has emerged as a significant contributor to cancer progression through multiple mechanisms related to fatty acid metabolism. Research indicates that Fads2 is abnormally expressed in various malignancies, including breast, lung, liver, and esophageal cancers, as well as melanoma and leukemia . The enzyme's activity influences tumor biology through several pathways:

  • Membrane Phospholipid Composition: Aberrant Fads2 expression alters the balance of cell membrane phospholipids, disrupting membrane fluidity and structure. These changes affect receptor signaling, membrane protein function, and cellular adaptation to the tumor microenvironment .

  • Signal Transduction: The dysregulation of Fads2 impacts signal transmission pathways critical for cell proliferation, survival, and metastatic potential. By modifying the availability of specific polyunsaturated fatty acids, Fads2 activity can amplify or attenuate oncogenic signaling cascades.

  • Inflammatory Mediators: Fads2-mediated production of arachidonic acid (AA) leads to increased synthesis of proinflammatory eicosanoids through the cyclooxygenase and lipoxygenase pathways. These inflammatory mediators promote tumor growth, angiogenesis, and immune evasion .

  • Ferroptosis Regulation: Recent studies have implicated Fads2 in the regulation of ferroptosis, an iron-dependent form of programmed cell death. Alterations in Fads2 activity can modify cellular susceptibility to ferroptosis, potentially affecting therapeutic responses .

The involvement of Fads2 in multiple aspects of tumor biology makes it an intriguing target for experimental cancer models, with potential implications for both understanding disease mechanisms and developing novel therapeutic approaches.

What are the current challenges in characterizing the three-dimensional structure of Fads2?

Despite its biological significance, the three-dimensional structure of Fads2 remains unresolved by X-ray crystallography, presenting several substantial challenges to structural biologists:

  • Membrane Protein Crystallization Barriers:

    • As a hydrophobic membrane-bound protein, Fads2 is exceptionally recalcitrant to conventional crystallization approaches .

    • The amphipathic nature of membrane proteins requires specialized detergents or lipid systems that often interfere with crystal formation.

    • Structural flexibility, particularly in the membrane-spanning regions, may prevent the formation of ordered crystals necessary for diffraction studies.

  • Protein Production Limitations:

    • Obtaining sufficient quantities of properly folded, homogeneous protein presents a significant obstacle.

    • The requirement for a native-like lipid environment to maintain physiological conformation complicates purification and crystallization efforts.

    • Post-translational modifications and potential heterogeneity in cofactor binding (particularly for the heme group) introduce additional variability.

  • Alternative Structural Approaches:

    • Cryo-electron microscopy (cryo-EM) offers promise for membrane protein structure determination but requires optimization for proteins of Fads2's size (~50 kDa).

    • Computational approaches including homology modeling based on related desaturases (such as stearoyl-CoA desaturase with Δ9 desaturation activity) provide partial insights but lack experimental validation.

    • NMR studies on specific domains, particularly the cytochrome b5-like domain, may offer fragment-based structural information.

The absence of a high-resolution structure significantly impedes understanding of the precise molecular mechanisms underlying Fads2's substrate specificity, catalytic mechanism, and interaction with other components of the fatty acid desaturation machinery.

How do dietary factors influence Fads2 expression and activity in mouse models?

Dietary factors exert profound effects on Fads2 expression and activity through multiple regulatory mechanisms:

  • Substrate Availability Regulation:

    • Studies show that dietary levels of essential fatty acids (linoleic acid and α-linolenic acid) inversely correlate with Fads2 expression, suggesting a compensatory mechanism when substrate availability is limited.

    • High dietary intake of preformed LC-PUFAs (EPA, DHA) downregulates Fads2 expression through feedback inhibition mechanisms.

  • Nutritional Status Sensors:

    • Fasting and feeding cycles modulate Fads2 expression through interconnections with energy-sensing pathways.

    • Transcription factors responsive to nutritional status, including SREBP-1c, PPARα, and LXR, directly regulate Fads2 transcription.

  • Dietary Pattern Interactions:

    • Research has demonstrated that dietary patterns interact with Fads2 genotypes to influence metabolic outcomes. For instance, the rs174583 polymorphism shows differential effects depending on dietary context .

    • The composition of dietary macronutrients (carbohydrate:fat ratio) influences Fads2 regulation, with high-carbohydrate diets typically increasing expression through SREBP-1c activation.

  • Micronutrient Dependencies:

    • Zinc adequacy is critical for optimal Fads2 function, as it serves as a cofactor for the enzyme.

    • Bioactive food components, including certain polyphenols and carotenoids, can modulate Fads2 expression through epigenetic mechanisms.

These dietary influences on Fads2 regulation provide valuable experimental leverage for researchers investigating the interconnections between nutrition, genetics, and fatty acid metabolism in both health and disease models.

What methodological approaches are recommended for studying Fads2 interactions with other enzymes in the fatty acid metabolism pathway?

To comprehensively characterize Fads2 interactions with other enzymes in the fatty acid metabolism pathway, researchers should consider a multi-faceted approach:

  • Protein-Protein Interaction Studies:

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close spatial proximity to Fads2 in the endoplasmic reticulum

    • Co-immunoprecipitation followed by mass spectrometry to identify stable interacting partners

    • Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) to visualize interactions in living cells

    • Yeast two-hybrid screening modified for membrane proteins to systematically identify potential interactors

  • Metabolic Flux Analysis:

    • Stable isotope labeling of fatty acid precursors followed by metabolite tracking to quantify pathway kinetics

    • Simultaneous knockdown/overexpression experiments to identify rate-limiting steps and enzyme interdependencies

    • Mathematical modeling of pathway dynamics incorporating enzyme concentrations and activities

  • Multi-Omics Integration:

    • Correlation of transcriptomic profiles between Fads2 and related enzymes (elongases, other desaturases) across experimental conditions

    • Integrated analysis of lipidomic changes with enzyme expression levels to identify functional relationships

    • Systematic perturbation experiments (CRISPR screens, chemical inhibition) to map pathway dependencies

  • Pathway Reconstitution:

    • In vitro reconstitution of minimal pathway components in artificial membrane systems

    • Cell-free expression systems to study coupled enzyme activities

    • Synthetic biology approaches to rebuild and modify pathway architecture

These methodological approaches, when applied in combination, provide a comprehensive understanding of how Fads2 functions within the broader context of fatty acid metabolism, enabling researchers to identify regulatory nodes and potential intervention points.

How can Fads2 research contribute to understanding human metabolic disorders?

Fads2 research in mouse models provides significant insights into human metabolic disorders through several translational pathways:

  • Genetic Association Validation:

    • Human genetic studies have identified FADS2 polymorphisms associated with metabolic traits, including plasma lipid levels, insulin sensitivity, and adiposity measures .

    • Mouse models enable functional validation of these genetic associations through targeted mutation of orthologous sites, providing mechanistic understanding of how specific variants influence metabolic phenotypes.

  • Dietary Interaction Models:

    • Studies examining interactions between FADS2 genotypes and dietary patterns reveal how genetic variation modifies nutritional responses.

    • Mouse models with humanized FADS2 variants allow controlled dietary intervention studies not feasible in human populations, informing personalized nutrition approaches.

  • Pathway Dysregulation in Disease States:

    • Alterations in FADS2 expression and activity have been implicated in metabolic diseases including obesity, non-alcoholic fatty liver disease, and diabetes.

    • Tissue-specific Fads2 manipulation in mice enables detailed investigation of how LC-PUFA metabolism contributes to organotypic pathologies in these conditions.

  • Therapeutic Target Assessment:

    • Pharmacological or genetic modulation of Fads2 in mouse models allows evaluation of this pathway as a potential therapeutic target.

    • Preclinical studies can assess efficacy, mechanism of action, and potential off-target effects of Fads2-targeted interventions before human translation.

This translational research pipeline connects fundamental insights from mouse Fads2 biology to human metabolic health, potentially informing both diagnostic approaches and therapeutic strategies for metabolic disorders.

What are the recommended controls and validation steps for Fads2 gene expression studies?

Robust Fads2 gene expression studies require comprehensive controls and validation steps to ensure reliability and reproducibility:

  • Reference Gene Selection:

    • Validate multiple reference genes (e.g., GAPDH, β-actin, 18S rRNA) under experimental conditions to identify those with minimal variation.

    • Use geometric averaging of multiple reference genes rather than relying on a single reference.

    • Consider tissue-specific reference genes, as Fads2 is expressed differently across tissues.

  • Primer Validation:

    • Design primers spanning exon-exon junctions to prevent amplification of genomic DNA.

    • Verify primer specificity through melt curve analysis, sequencing of PCR products, and testing in Fads2 knockout tissues.

    • Determine PCR efficiency using standard curves and ensure efficiency between 90-110%.

  • Experimental Controls:

    • Include positive controls (tissues known to express high Fads2 levels, such as liver) and negative controls (tissues with minimal expression).

    • For knockdown/knockout studies, include heterozygous samples to assess dose-dependent effects.

    • When studying dietary or environmental effects, include time course controls to distinguish acute versus chronic responses.

  • Protein-Level Validation:

    • Confirm changes in mRNA expression translate to protein level changes using Western blotting or ELISA .

    • Assess enzyme activity through direct measurement of desaturation products rather than assuming correlation with expression levels.

  • Statistical Considerations:

    • Account for potential covariates that might influence Fads2 expression (age, sex, nutritional status).

    • Perform power calculations to ensure adequate sample size for detecting biologically relevant differences.

    • Use appropriate statistical methods for analyzing qPCR data, such as the 2^(-ΔΔCt) method with proper error propagation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.