Recombinant Mouse Fatty acid desaturase 3 (Fads3)

Shipped with Ice Packs
In Stock

Description

Tissue-Specific Expression

In mice, Fads3 mRNA is highly expressed in:

  • Lung, white adipose tissue (WAT), aorta, spleen, heart, and kidney .

  • Low expression in pancreas, skeletal muscle, and abdominal muscles .

Protein Isoforms

  • Tissue Dependency: Isoform distribution (75 kDa, 51 kDa, 37 kDa) does not correlate with mRNA levels, suggesting post-transcriptional regulation .

  • Rodent Comparison: Rat Fads3 isoforms mirror mouse patterns but show distinct tissue distributions .

Enzymatic Activity and Biochemical Role

Recombinant mouse Fads3 is implicated in:

  • Δ13-Desaturation: Catalyzes the conversion of trans-vaccenic acid (18:1n-7) to trans11, cis13-conjugated linoleic acid (CLA) in vitro .

  • Lipid Metabolism: Participates in biohydrogenation pathways, influencing long-chain polyunsaturated fatty acid (LC-PUFA) biosynthesis .

Table 2: Comparison of Fads1, Fads2, and Fads3 in Mice

PropertyFads1 (Δ5-Desaturase)Fads2 (Δ6-Desaturase)Fads3 (Δ13-Desaturase)
Primary ActivityΔ5-desaturationΔ6-desaturationΔ13-desaturation
Tissue ExpressionLiver, brainLiver, kidneyLung, WAT, aorta
Key SubstratesDihomo-γ-linolenic acidLinoleic acidtrans-vaccenic acid

Recombinant Protein Use

  • Positive Control: In SDS-PAGE and Western blot (WB) to validate antibody specificity .

  • Immunogen: For generating polyclonal/monoclonal antibodies targeting N-terminal or C-terminal regions .

Detection Antibodies

Antibody TypeApplicationsTissue Reactivity
Polyclonal (PAF418Hu01)WB, IHC, IPMouse, rat, human
Monoclonal (MAF418Hu21)WB, IHC, IPMouse, rat, human

ELISA Kits

  • Rat Fads3 ELISA (SEF418Hu): Detects Fads3 in serum, plasma, or cell lysates with a sensitivity of 0.056 ng/mL .

Transcriptional Control

  • Targeted by: NK-κB, MYCN, and p63 transcription factors, linking Fads3 to cell survival pathways .

  • Polymorphisms: Correlate with lipid markers (cholesterol, triglycerides) and metabolic disorders .

Disease Associations

  • Metabolic Disorders: Altered Fads3 expression may influence PUFA profiles in obesity or inflammation .

  • Brain Development: Fads3 knockout mice show reduced DHA in brain tissue, suggesting a role in neurodevelopment .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. We recommend contacting your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipment, please contact us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
While the tag type is determined during production, we are open to accommodating specific tag preferences. If you require a particular tag type, please specify it, and we will prioritize development accordingly.
Synonyms
Fads3; MNCb-0629; Fatty acid desaturase 3; Delta(13 fatty acid desaturase; Delta(13 desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fads3
Target Protein Sequence
MGGVGEPGGGPGPREGPAPLGAPLPIFRWEQIRQHDLPGDKWLVIERRVYDISRWAQRHP GGSRLIGHHGAEDATDAFHAFHQDLHFVRKFLKPLLIGELAPEEPSQDGAQNAQLIEDFR ALRQAAEDMKLFEADTTFFALLLGHILAMELLAWLIIYLLGPGWVSSILAALILAISQAQ CWCLQHDLGHASIFTKSRWNHVAQQFVMGQLKGFSAHWWNFRHFQHHAKPNIFHKDPDVT VAPVFLLGESSVEYGKKKRRYLPYNHQHLYFFLIGPPLLTLVNFEVENLAYMLVCMQWTD LLWAASFYSRFFLSYSPFYGATGTLLLFVAVRVLESHWFVWITQMNHIPKEIGHEKHRDW ASSQLAATCNVEPSLFIDWFSGHLNFQIEHHLFPTMPRHNYRRVAPLVKAFCAKHGLHYE VKPFLTALVDIIGSLKKSGDIWLDAYLHQ
Uniprot No.

Target Background

Function
Mammals exhibit diverse sphingoid bases, differentiated by their length and/or desaturation and hydroxyl group patterns. Sphing-4-enine (sphingosine or SPH), with a trans desaturation at carbon 4, is the predominant sphingoid base in mammalian ceramides. FADS3, a ceramide desaturase, introduces a cis double bond between carbons 14 and 15 of SPH-containing ceramides, resulting in the production of sphinga-4,14-dienine-containing ceramides (SPD ceramides). Widely distributed in mammalian tissues and cells, SPD ceramides, due to their unique cis double bond structure, may play an opposing, negative role in lipid microdomain formation compared to conventional ceramides. FADS3 also acts as a methyl-end fatty acyl coenzyme A (CoA) desaturase, introducing a cis double bond between the preexisting double bond and the terminal methyl group of the fatty acyl chain. This enzyme desaturates (11E)-octadecenoate (trans-vaccenoate, the predominant trans fatty acid in human milk) at carbon 13, generating (11E,13Z)-octadecadienoate (also known as conjugated linoleic acid 11E,13Z-CLA).
Gene References Into Functions
  1. Fads3 enhances liver-mediated 22:6n-3 synthesis, contributing to brain 22:6n-3 accretion both before and during the brain growth spurt. PMID: 28838557
  2. Changes in expression patterns and fatty acid profiles suggest that Fads3AT9 may play a role in the regulation and/or biosynthesis of long chain polyunsaturated fatty acids from precursors. PMID: 27216536
  3. FADS3 exists in multiple protein isoforms, depending on the mammalian tissue. PMID: 19752397
Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in liver and kidney (at protein level).

Q&A

What is Fatty Acid Desaturase 3 (Fads3) and how does it differ from other desaturases?

Fads3 is a member of the fatty acid desaturase gene family clustered with Fads1 and Fads2. While Fads1 and Fads2 encode for Δ5- and Δ6-desaturases respectively (involved in polyunsaturated fatty acid biosynthesis), Fads3 appears to have distinct functionality. Fads3 shares 62% nucleotide sequence identity with Fads1 and 70% with Fads2, suggesting evolutionary relationships while maintaining unique properties . The protein is predicted to function as a methyl-end fatty acyl coenzyme A (CoA) desaturase that introduces a cis double bond between a preexisting double bond and the terminal methyl group of fatty acyl chains . Unlike its better-characterized counterparts, Fads3's full physiological role remains under investigation, with recent evidence suggesting it participates in the biohydrogenation pathway of linoleic acid .

What is the predicted structure of mouse Fads3 protein?

Mouse Fads3 is predicted to be a membrane-bound desaturase composed of two primary domains: an N-terminal cytochrome b5-like domain and a C-terminal fatty acid desaturase domain . These structural features are consistent with front-end desaturase functionality, similar to Fads1 and Fads2. The specific amino acid sequences at the N-terminal (31QIRQHDLPGDKWL) and C-terminal (352PKEIGHEKHRDWAS) ends have been used to develop antibodies for research purposes, with the C-terminal sequence showing 100% identity between rat and human proteins . This structural organization suggests Fads3 likely plays a role in fatty acid metabolism, though its specific substrates and products may differ from other family members.

What molecular weight isoforms of Fads3 exist in mouse tissues?

Research has identified three potential protein isoforms of Fads3 in mouse tissues with approximate molecular weights of 75 kDa, 51 kDa, and 37 kDa . These isoforms appear in a tissue-dependent manner, suggesting differential post-transcriptional or post-translational processing mechanisms. Interestingly, the occurrence pattern of these isoforms does not directly correlate with mRNA expression levels as determined by real-time PCR . The existence of multiple isoforms likely reflects the complex regulatory mechanisms controlling Fads3 expression and function, potentially allowing for tissue-specific roles in fatty acid metabolism. These isoforms may have distinct catalytic activities or substrate preferences, contributing to the complexity of Fads3 biology.

How does the tissue distribution of Fads3 compare to other Fads genes in mice?

The expression pattern of Fads3, as measured by mRNA levels, differs significantly from that of Fads1 and Fads2. While Fads1 and Fads2 show similar mRNA profiles with highest expression in liver, kidney, brain, lung, and aorta, Fads3 mRNAs are predominantly found in lung, white adipose tissue, aorta, spleen, heart, and kidney . All three Fads genes show low expression in pancreas and skeletal/abdominal muscles, while aorta, lung, and kidney consistently demonstrate high transcript levels for all three genes . This differential expression pattern suggests that Fads3 may play specialized physiological roles distinct from the other desaturases. Additionally, sex-specific differences in expression have been observed for all Fads genes, with significant effects of sex, tissue type, and the interaction between sex and tissue on mRNA levels (p < 10^-5) .

How does the protein expression of Fads3 correlate with its mRNA levels in different tissues?

An intriguing aspect of Fads3 biology is that protein expression does not directly correlate with mRNA levels across tissues . This discrepancy suggests complex post-transcriptional regulation mechanisms influencing Fads3 protein production and stability. The three identified protein isoforms (75 kDa, 51 kDa, and 37 kDa) show tissue-dependent distribution patterns that cannot be predicted solely from transcript abundance. This lack of correlation between mRNA and protein levels highlights the importance of studying both transcriptional and translational regulation of Fads3. Researchers should therefore employ both mRNA quantification methods (such as real-time PCR) and protein detection techniques (such as Western blotting with specific antibodies) when investigating Fads3 expression in experimental systems.

Are there species differences in Fads3 expression patterns?

Yes, significant species differences exist in Fads3 expression patterns. While rat, mouse, and human tissues all express multiple Fads3 protein isoforms, the tissue distribution patterns differ between species . Notably, rats and mice show the same three major isoforms (75 kDa, 51 kDa, and 37 kDa), but their tissue distribution varies . In humans, different isoform patterns have been identified compared to rodents . These species differences are critical considerations when extrapolating findings between animal models and human studies. Researchers should be cautious when making cross-species comparisons and should validate expression patterns in their specific species of interest. These differences may reflect evolutionary adaptations related to diet, metabolism, or other physiological factors.

What are the recommended antibodies for detecting mouse Fads3 in experimental studies?

For reliable detection of mouse Fads3, researchers have successfully employed polyclonal antibodies directed against specific epitopes. Two particularly effective approaches include antibodies targeting the N-terminal sequence (31QIRQHDLPGDKWL) and the C-terminal sequence (352PKEIGHEKHRDWAS) of rat Fads3, which show high sequence conservation with mouse Fads3 . These antibodies, referred to as anti-NtermFADS3 and anti-CtermFADS3, allow for specific detection of Fads3 protein isoforms in various tissues . Additionally, some researchers have utilized antibodies that recognize both Fads2 and Fads3 (anti-FADS2/3), though these offer less specificity . When selecting antibodies for mouse Fads3 research, consider the specific isoforms of interest and potential cross-reactivity with other Fads family members. Validation of antibody specificity using recombinant Fads3 proteins is recommended before proceeding with tissue analyses.

What is the optimal protocol for measuring Fads3 protein levels in mouse tissues?

For accurate quantification of Fads3 protein levels in mouse tissues, a sandwich ELISA approach is recommended, with commercially available kits offering detection ranges of 0.156-10 ng/ml and sensitivity of approximately 0.089 ng/mL . This method provides excellent reproducibility with intra-assay and inter-assay coefficient variations of 5.5% and 7.9%, respectively . For Western blot analysis, tissue homogenization in appropriate buffer followed by SDS-PAGE separation on 10-12% gels has proven effective for visualizing the three Fads3 isoforms (75 kDa, 51 kDa, and 37 kDa) . Given the tissue-specific expression patterns, researchers should optimize protein extraction protocols for their specific tissue of interest. Additionally, comparative analysis between tissues should account for the presence of different isoforms, which may require normalization strategies beyond traditional housekeeping proteins.

How can researchers effectively measure Fads3 mRNA expression?

Real-time PCR (qPCR) has been successfully employed to quantify Fads3 mRNA levels in various tissues . When designing primers for mouse Fads3, researchers should account for potential alternative splicing, as different splice variants may exist . Reference genes should be carefully selected based on the tissue type being studied, as traditional housekeeping genes may exhibit variable expression across different tissues. For microarray analyses, probes such as 204257_at and 216080_s_at have been used successfully to detect Fads3 expression in adipose tissue . RNA sequencing provides comprehensive transcriptome analysis, allowing for detection of novel splice variants and more accurate quantification of expression levels. Regardless of the method chosen, validation across multiple techniques is recommended, especially when studying tissues with complex transcriptional landscapes.

What is the enzymatic function of recombinant mouse Fads3?

Current evidence suggests mouse Fads3 functions as a methyl-end fatty acyl coenzyme A (CoA) desaturase that introduces a cis double bond between a preexisting double bond and the terminal methyl group of the fatty acyl chain . Specifically, it desaturates (11E)-octadecenoate (trans-vaccenoate) at carbon 13 to generate (11E,13Z)-octadecadienoate . This activity indicates Fads3 likely participates in the biohydrogenation pathway of linoleic acid (LA, 18:2n-6) . Unlike Fads1 and Fads2, which are well-characterized as Δ5 and Δ6 desaturases respectively in the polyunsaturated fatty acid synthesis pathway, Fads3's precise role in lipid metabolism continues to be investigated. The enzymatic properties of recombinant Fads3 include substrate specificity that differs from its family members, suggesting a complementary rather than redundant role in fatty acid metabolism.

How does Fads3 interact with other components of fatty acid metabolism pathways?

Fads3 appears to have complex interactions with other components of fatty acid metabolism pathways. Research has shown enhanced mRNA expression of Fads3 in the liver of Fads2 knockout (Fads2-/-) mice, suggesting potential compensatory mechanisms between these related enzymes . This relationship indicates Fads3 may play a role in alternative pathways for lipid metabolism when conventional routes are compromised. The connection between Fads3 and other fatty acid metabolism enzymes likely involves coordinated regulation of expression, shared cofactors, or sequential processing of fatty acid intermediates. Understanding these interactions is crucial for elucidating the complete physiological role of Fads3 and may provide insights into potential redundancy or specialization within the Fads gene family. Future research using protein-protein interaction studies and metabolic flux analyses will help clarify these relationships.

What factors regulate Fads3 expression and activity?

Fads3 expression appears to be regulated by multiple factors, including genetic variants, transcription factors, and possibly metabolic conditions. The upstream transcription factor 1 (USF1) has been implicated in regulating Fads3 expression, with the SNP rs3737787 in the USF1 gene region showing association with a co-expression module that includes Fads3 . Additionally, SNPs within the Fads1-2-3 genomic region (rs174547 and rs102275) have been associated with expression levels of Fads genes, with stronger effects on Fads1 than Fads3 . Sex-specific differences in Fads3 expression across tissues suggest hormonal regulation may also play a role . Metabolic conditions may influence Fads3 activity, as suggested by its altered expression in Fads2 knockout mice . Understanding these regulatory mechanisms is essential for interpreting experimental results and designing interventions targeting Fads3 function in research contexts.

What is the association between Fads3 and lipid metabolism disorders?

Fads3 has been implicated in lipid metabolism disorders, particularly Familial Combined Hyperlipidemia (FCHL) and related traits. Research has identified Fads3 as one of 18 causal candidate genes for FCHL in a systems genetics approach . Increasing expression of Fads3 was associated with increased risk for FCHL in adipose tissue (correlation = 0.31, p-value = 0.0084) . Genetic variants in the Fads1-2-3 genomic region, specifically rs174547 and rs102275, have been associated with hypertriglyceridemia, with the major alleles of both SNPs showing significant association (rs174547 p-value = 0.024, rs102275 p-value = 0.012) . Interestingly, while the allele frequencies of these SNPs differ between Mexican and Caucasian populations, the direction of association remains consistent, suggesting a conserved role of this genomic region in triglyceride metabolism across ethnic groups . These findings highlight the potential importance of Fads3 in lipid homeostasis and metabolic health.

How does Fads3 expression change in Fads2 knockout mouse models?

Studies have revealed enhanced mRNA expression of Fads3 in the liver of Fads2 knockout (Fads2-/-) mice . This upregulation suggests a potential compensatory mechanism wherein Fads3 may partially substitute for the loss of Fads2 function. Fads2 deletion modifies enzymatic pathways of long-chain polyunsaturated fatty acid biosynthesis, causing various pathologies while not impairing normal lifespan . The close relationship between Fads2 and Fads3 expression in these knockout models indicates the putative involvement of Fads3 in fatty acid metabolism. This compensatory expression pattern provides valuable insights into the functional redundancy within the Fads gene family and suggests that Fads3 may represent an alternative pathway for fatty acid processing when conventional routes are compromised. Researchers working with Fads knockout models should monitor expression changes across all family members to fully understand the metabolic adaptations occurring in these systems.

What are the potential implications of Fads3 polymorphisms for personalized nutrition research?

Fads3 polymorphisms may have significant implications for personalized nutrition research, particularly in the context of polyunsaturated fatty acid metabolism. Studies have shown significant correlations between Fads3 polymorphisms and lipid metabolism markers, including PUFA, high-density lipoprotein cholesterol, low-density lipoprotein cholesterol, and triglyceride levels . The notable population differences in allele frequencies for Fads gene cluster SNPs (like rs174547 and rs102275) between ethnic groups suggest that dietary recommendations based on genetic profiles may need to be population-specific . The consistent direction of effect across populations, despite frequency differences, indicates conserved biological mechanisms. Additionally, the tissue-specific expression patterns of Fads3 suggest that its role in lipid metabolism may vary across tissues, potentially affecting how different organs respond to dietary interventions. These findings highlight the potential value of including Fads3 genotyping in nutrigenetic analyses aimed at optimizing dietary fat recommendations for individuals or population subgroups.

How can recombinant Fads3 be effectively produced for structural and functional studies?

For structural and functional studies of mouse Fads3, recombinant protein production typically involves expression in mammalian cell systems that can properly process membrane proteins with correct post-translational modifications. Researchers have successfully employed specific expression vectors containing the full Fads3 coding sequence, often with epitope tags to facilitate purification and detection . When designing expression constructs, consideration should be given to the predicted membrane-associated nature of Fads3, which includes an N-terminal cytochrome b5-like domain and a C-terminal fatty acid desaturase domain . Purification strategies often involve detergent solubilization followed by affinity chromatography. For functional assays, enzymatic activity can be assessed by measuring the conversion of (11E)-octadecenoate to (11E,13Z)-octadecadienoate using techniques such as gas chromatography-mass spectrometry . Given the tissue-specific expression of different Fads3 isoforms, researchers should consider producing multiple variants to comprehensively characterize the functional diversity of this enzyme family.

What are the most promising research directions for elucidating the complete physiological role of Fads3?

Several promising research directions could help elucidate the complete physiological role of Fads3. First, development of tissue-specific and inducible Fads3 knockout mouse models would allow for detailed analysis of its function in different contexts while avoiding developmental complications. Second, comprehensive characterization of the multiple Fads3 protein isoforms through proteomics approaches could reveal tissue-specific functions and regulatory mechanisms. Third, investigation of Fads3's role in different pathological conditions, particularly those involving lipid metabolism disorders, may provide insights into its contribution to disease processes. Fourth, exploring the evolutionary conservation of Fads3 across species could help identify fundamental functions preserved through natural selection. Finally, integrating multi-omics approaches (genomics, transcriptomics, proteomics, and metabolomics) in systems biology frameworks will provide a holistic understanding of Fads3's position within complex metabolic networks. These approaches collectively have the potential to resolve the current knowledge gaps regarding this enigmatic member of the fatty acid desaturase family.

What control proteins should be included when studying Fads3 expression?

When studying Fads3 expression, appropriate controls should include other members of the Fads gene family (Fads1 and Fads2) to account for potential compensatory mechanisms and to establish specificity of observed effects . Additionally, well-characterized membrane proteins of similar size and topology should be included as controls for fractionation and isolation procedures, given Fads3's predicted membrane localization. For antibody-based detection methods, specificity controls including pre-incubation with immunizing peptides and testing in tissues known to express varying levels of Fads3 are essential . When examining transcriptional regulation, controls should include upstream factors like USF1 that have been implicated in Fads3 regulation . For functional studies, enzymatic controls with known desaturase activity can provide reference points for activity measurements. The choice of housekeeping genes or proteins for normalization should be carefully validated across the specific tissues being studied, as traditional reference genes may show variable expression across different tissues or under experimental conditions.

How should researchers address the challenge of multiple Fads3 isoforms in experimental design?

The presence of multiple Fads3 isoforms (75 kDa, 51 kDa, and 37 kDa) presents a significant challenge for experimental design . Researchers should employ antibodies capable of detecting all known isoforms or use isoform-specific antibodies when focusing on particular variants. When designing PCR primers or expression constructs, consideration should be given to potential alternative splicing or post-translational modifications that generate these isoforms. For functional characterization, each isoform should ideally be expressed and analyzed separately to determine potential differences in substrate specificity, activity, or regulation. When analyzing tissue samples, protein extraction methods should be optimized to ensure efficient recovery of all isoforms, particularly given their membrane-associated nature. Statistical analyses should account for the tissue-dependent distribution of isoforms, potentially treating them as separate variables rather than combining their measurements. Researchers should clearly specify which isoforms are being targeted in their experiments to facilitate comparison across studies and accurate interpretation of results.

What are the key considerations for designing Fads3 knockout or overexpression models?

When designing Fads3 knockout or overexpression models, several key considerations should guide experimental planning. First, given the potential compensatory upregulation observed between Fads genes (as seen with Fads3 in Fads2-/- mice), researchers should monitor expression changes in all family members . Second, the tissue-specific expression patterns of Fads3 suggest that phenotypes may vary depending on the tissues affected, making tissue-specific or inducible systems potentially more informative than global knockouts . Third, the existence of multiple protein isoforms complicates targeting strategies – researchers must decide whether to eliminate all isoforms or specific variants . Fourth, for overexpression models, the choice of promoter should reflect physiological expression patterns when possible, and overexpression constructs should include proper trafficking signals to ensure correct subcellular localization. Fifth, given Fads3's association with lipid metabolism, phenotyping should include comprehensive lipidomic analyses across multiple tissues, potentially under various dietary conditions or challenges. Finally, considering the association with triglyceride metabolism and FCHL, metabolic phenotyping should examine both baseline parameters and responses to physiological challenges like high-fat feeding or fasting.

How should researchers interpret discrepancies between Fads3 mRNA and protein expression levels?

The observed discrepancies between Fads3 mRNA and protein expression levels across tissues present an interpretative challenge . When encountering such discrepancies, researchers should consider several potential explanations. First, post-transcriptional regulatory mechanisms, including microRNA targeting, RNA binding proteins, or alterations in mRNA stability, may influence the efficiency of translation from Fads3 transcripts. Second, post-translational modifications or protein turnover rates may differ between tissues, affecting steady-state protein levels independently of mRNA abundance. Third, the presence of multiple protein isoforms complicates quantification, as different antibodies may have varying affinities for each isoform . To address these challenges, researchers should employ multiple methodologies for both mRNA and protein quantification, including isoform-specific approaches when possible. Time-course studies may help elucidate the relationship between transcription and translation. Additionally, investigation of tissue-specific regulatory factors could provide mechanistic insights into the observed discrepancies. Ultimately, functional measures of Fads3 activity may be more informative than absolute expression levels in some experimental contexts.

What statistical approaches are recommended for analyzing Fads3 association with metabolic traits?

For analyzing Fads3 association with metabolic traits, several statistical approaches have proven effective in previous research. When examining genetic associations, such as those between SNPs in the Fads1-2-3 genomic region and triglyceride levels, standard genetic association tests with appropriate correction for multiple testing have been successfully applied (yielding significant associations with p-values of 0.024 for rs174547 and 0.012 for rs102275) . For expression data, correlation analyses between Fads3 expression and disease status have revealed significant associations (correlation = 0.31, p-value = 0.0084 for FCHL status) . More sophisticated approaches include weighted gene co-expression network analysis (WGCNA), which has successfully identified Fads3 as part of co-expression modules associated with triglycerides and FCHL . This systems genetics approach allows for the identification of causal candidate genes within complex networks. When analyzing multiple tissues or isoforms, multivariate approaches or mixed models may be appropriate to account for tissue-specific effects and within-subject correlations. Researchers should consider potential confounding factors such as sex, which has shown significant interaction effects with tissue type on Fads gene expression (p < 10^-5) .

How can researchers distinguish the specific role of Fads3 from other Fads family members in experimental outcomes?

Distinguishing the specific role of Fads3 from other Fads family members requires carefully designed experimental approaches. One effective strategy involves using isoform-specific knockdown or knockout models that target Fads3 while preserving Fads1 and Fads2 function. RNA interference or CRISPR-Cas9 techniques with carefully designed guides can achieve this specificity. Complementary approaches include rescue experiments where Fads3 is reintroduced into knockout systems to confirm phenotype reversal. When using antibody-based detection methods, verification of specificity through pre-incubation with immunizing peptides or testing in knockout tissues is essential . For functional assays, substrate specificity differences can help differentiate Fads3 activity, as it appears to process different fatty acid substrates than Fads1 and Fads2 . The unique tissue distribution pattern of Fads3 compared to other family members provides another distinguishing feature – effects observed in tissues with high Fads3 but low Fads1/2 expression (like white adipose tissue) are more likely attributable to Fads3 . Finally, temporal expression patterns during development or in response to stimuli may differ between family members, providing another dimension for distinguishing their specific roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.