Recombinant Mouse Fc receptor-like protein 6 (Fcrl6)

Shipped with Ice Packs
In Stock

Description

Expression and Cellular Distribution

Fcrl6 is selectively expressed by cytotoxic lymphocytes:

  • Natural Killer (NK) Cells: Found on perforin-expressing subsets involved in target cell lysis .

  • CD8+ T Cells: Upregulated in terminally differentiated effector populations, particularly during chronic immune activation (e.g., HIV, cancer) .

  • CD4+ T Cells: Rare in healthy individuals but expanded in pathological conditions like HIV infection .

Ligand Interaction

  • Reporter Assays: Engineered FCRL6ζ chimeric proteins (extracellular Fcrl6 + CD3ζ cytoplasmic domain) induce GFP expression in murine T cell hybridomas upon ligand engagement, confirming functional signaling .

  • Soluble Fcrl6-Fc Fusion: Recombinant mouse Fcrl6-Fc binds HLA-DR in human studies, suggesting cross-species reactivity .

Inhibitory Role

Fcrl6 dampens cytotoxic lymphocyte activity via ITIM-mediated phosphatase recruitment:

  • NK Cell Cytotoxicity: Forced Fcrl6 expression in NK-92 cells reduces killing of HLA-DR+ targets by 40–60% .

  • T Cell Function: Blocking Fcrl6 ligation enhances IFNγ production by CD8+ T cells during antigenic stimulation .

Research Applications

Recombinant mouse Fcrl6 is primarily used for:

  1. Ligand Identification: Soluble Fcrl6-Fc chimeras screen for binding partners in cell lines and primary leukocytes .

  2. Immune Modulation Studies: CRISPR-edited or transduced lymphocytes assess Fcrl6’s impact on cytotoxicity and cytokine profiles .

  3. Disease Modeling: Elevated Fcrl6+ lymphocytes correlate with tumor immune evasion in melanoma and breast cancer models .

Comparative Analysis: Mouse vs. Human FCRL6

AspectMouse Fcrl6Human FCRL6
Ligand SpecificityUndeterminedConfirmed HLA-DR interaction
ExpressionCytotoxic NK/T cellsIdentical + expanded in chronic diseases
Signaling MechanismITIM/SHP-2 recruitmentITIM/SHP-2 recruitment

Key Research Findings

  • Tumor Microenvironment: Fcrl6+ lymphocytes are enriched in MHC class II+ tumors, correlating with reduced granzyme B+ cytotoxic cells and poor response to PD-1 blockade .

  • Chronic Lymphocytic Leukemia (CLL): Mouse models show Fcrl6 upregulation on NK/T cells, mirroring human CLL profiles .

  • Structural Studies: X-ray crystallography of human FCRL6-HLA-DR complexes predicts conserved binding interfaces applicable to murine studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Fcrl6; Fc receptor-like protein 6; FcR-like protein 6; FcRL6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-268
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
QELFPNPELTEFTNSETMDVILKCTIKVDPKNPTLQLFYTFYKNNHVIQDRSPHSVFSAEAKEENSGLYQCMVDTEDGLIQKKSGYLDIQFWTPVSHPVLTLQHEATNLAVGDKVEFLCEAHQGSLPIFYSFYINGEILGKPLAPSGRAASLLASVKAEWSTKNYSCEAKNNISREISELKKFPLVVSGTAWIKSNMLPIWLPASLLGGMVIAAVVLMYFFKPCKKHARPETPTLKEPDSFLYVSVDNQRYK
Uniprot No.

Target Background

Function
Fc receptor-like protein 6 (Fcrl6) acts as a MHC class II receptor. When stimulated independently, it does not contribute to cytokine production or the release of cytotoxic granules by natural killer (NK) cells and cytotoxic CD8(+) T cells. It does not function as an Fc receptor.
Database Links
Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is mouse FCRL6 and how does it differ from human FCRL6?

Mouse FCRL6 is an immunoreceptor belonging to the Fc receptor-like family that is primarily expressed on specific subpopulations of B cell progenitors. It plays a critical role in distinguishing cell populations with different developmental potentials, particularly correlating with fetal versus adult B-1a development . This expression pattern differs significantly from human FCRL6, which is primarily expressed on cytotoxic NK and T cells but not B cells. The rat FCRL6 ortholog (termed gp42) shares a similar expression pattern with the human version rather than the mouse version . Despite these expression differences, both mouse and human FCRL6 appear to have important regulatory functions in their respective immune cell populations.

How is FCRL6 expression regulated during mouse B cell development?

FCRL6 expression is dynamically regulated during mouse B cell development and appears sensitive to cellular activation signals. While the genetic regulation of FCRL6 has not been explored in detail, studies show that FCRL6 distinguishes subpopulations of B cell progenitors throughout ontogeny . Expression patterns vary between fetal liver (FL) and bone marrow (BM) pro B cells, with FCRL6+ cells exhibiting protracted differentiation and proliferation compared to FCRL6- counterparts . Researchers can detect and quantify this developmental expression using quantitative PCR with primers designed to hybridize with the first extracellular domain of FCRL6. The recommended primer sequences are:

  • FCRL6F: 5′-CATGCTGCTCTGGATGGTTCT-3′

  • FCRL6R: 5′-AGCTCAGGATTTGGGAACAACTC-3′

These expression patterns suggest that FCRL6 marks distinct developmental trajectories within the B cell lineage with specific functional properties.

What are the recommended protocols for producing recombinant mouse FCRL6?

Producing recombinant mouse FCRL6 for research applications involves several key steps:

  • cDNA Amplification: PCR amplify the cDNA regions encoding the two extracellular Ig domains of mouse FCRL6 .

  • Cloning and Vector Construction: Clone the amplified cDNA into an expression vector such as pET24b (Novagen) for bacterial expression .

  • Bacterial Expression: Transform the construct into Escherichia coli for protein expression. The recombinant protein is typically designed with a His-tag to facilitate purification .

  • Protein Purification: Purify the His-tagged recombinant protein using affinity chromatography (nickel columns), followed by additional purification steps if needed .

  • Validation: Validate the purified protein through methods such as SDS-PAGE, Western blotting, and functional assays to ensure proper folding and activity.

This approach has been successfully used to generate recombinant mouse FCRL6 for antibody production and functional studies, yielding proteins that retain their native antigenic properties .

How can researchers generate and validate antibodies against mouse FCRL6?

Generating specific antibodies against mouse FCRL6 requires careful immunization and screening strategies:

Monoclonal Antibody Generation:

  • Immunize Fisher rats with E. coli-derived His-tagged recombinant protein comprising the two extracellular Ig domains of mouse FCRL6 at 3-4 day intervals over a 3-week period .

  • Harvest popliteal lymph nodes from immunized rats and fuse with mouse plasmacytoma Ag8.653 cells .

  • Plate the fusion products for selection in 96-well plates and screen hybridoma clones after 10-14 days .

  • Test specificity by staining hemagglutinin (HA)-tagged FCRL1, FCRL5, and FCRL6 transductants to ensure selectivity for FCRL6 .

Polyclonal Antibody Generation:
Hyperimmunize New Zealand White rabbits with the same E. coli-derived His-tagged recombinant FCRL6 protein .

Validation Methods:

  • Flow cytometry to confirm binding to FCRL6+ cells

  • Immunoprecipitation followed by Western blotting

  • Comparative analysis with isotype controls

  • Cross-reactivity testing against other FCRL family members

Researchers have successfully generated rat anti-mouse FCRL6-specific mAbs, including 1C3 (IgG1κ) and 3C1 (IgG2aκ), using these methods .

What detection methods are most effective for studying FCRL6 expression in mouse cells?

Multiple complementary techniques can effectively detect and quantify FCRL6 expression in mouse cells:

Flow Cytometry:
The gold standard for detecting FCRL6 protein expression on the cell surface. Use specific monoclonal antibodies such as rat anti-mouse FCRL6 mAbs 1C3 or 3C1 . FCRL6+ pro B cells can be identified as AA4.1+CD43+CD19+B220hiIgM- cells that also express FCRL6 .

Quantitative PCR (qPCR):
For detecting FCRL6 mRNA expression, use the following protocol:

  • Extract total RNA using RNeasy Plus kits (Qiagen)

  • Generate cDNA using SuperScript II (Invitrogen)

  • Perform qPCR with FCRL6-specific primers and SYBR green master mix

  • Normalize to Polr2a (RNA polymerase II) expression

Immunoprecipitation and Western Blotting:

  • Lyse cells in 1% NP-40 lysis buffer

  • Incubate lysates with anti-FCRL6 mAb (3C1) or isotype control

  • Add protein G beads and incubate overnight at 4°C

  • Resolve by SDS-PAGE and transfer to PDVF membranes

  • Immunoblot with rabbit anti-mouse FCRL6 polyclonal antibodies

Immunohistochemistry:
For tissue sections, use anti-FCRL6 antibodies with appropriate secondary detection systems to visualize the spatial distribution of FCRL6+ cells.

How does FCRL6 influence B cell receptor repertoire development?

FCRL6 expression significantly impacts B cell receptor (BCR) repertoire development in several key ways:

  • VH Gene Usage Bias: FCRL6+ progenitors yield VH repertoires with biased distal Ighv segment accessibility, creating a distinct antibody gene usage pattern .

  • Repertoire Diversity Restriction: FCRL6+ cells generate BCRs with constrained diversity and distinctive properties including hydrophobic and charged CDR-H3 sequences .

  • Autoreactive Potential: FCRL6+ FL and BM pro B cells generate nascent μ heavy chains with autoreactive properties, suggesting a role in the development of natural autoantibodies .

  • VH11 Enrichment: VH11 productivity, which predominates phosphatidylcholine-specific B-1a BCRs, is higher for FCRL6+ cells . This indicates FCRL6 marks progenitors with specific BCR characteristics relevant to natural antibody production.

  • Selection Pathway Discrimination: FCRL6 discriminates between pre-BCR dependent and independent selection pathways, with differential effects on VH11 and VH12 B-1a development .

These findings reveal FCRL6 as a marker that identifies progenitor populations with distinctive BCR repertoire characteristics, with implications for understanding the development of both protective natural antibodies and potentially pathogenic autoantibodies.

What is the relationship between FCRL6, pre-BCR signaling, and B-1a cell development?

The relationship between FCRL6, pre-BCR signaling, and B-1a cell development represents a complex developmental network:

Pre-BCR Signaling Correlation:

  • FCRL6+ pro B cells show higher pre-BCR formation rates compared to FCRL6- cells

  • Pre-BCR formation in FCRL6+ cells is required for Myc induction, a critical transcription factor in B cell proliferation and differentiation

  • This establishes FCRL6 as a marker for cells with specific pre-BCR signaling characteristics

B-1a Developmental Pathways:

  • FCRL6 expression distinguishes subpopulations with different B-1a developmental potential

  • Pre-BCR formation was specifically required for VH11, but not VH12, B-1a development in FCRL6+ cells

  • This indicates FCRL6 marks cells following distinct developmental pathways with varying dependencies on pre-BCR signaling

Transcriptional Programs:

  • FCRL6+ progenitors exhibit distinct transcript signatures including B-1a related defense, migration, and differentiation properties

  • These transcriptional differences suggest FCRL6 identifies cells programmed toward specific B-1a fates

This relationship provides critical insights into the heterogeneous origins of B-1a cells, revealing that FCRL6 can be used to distinguish between different developmental trajectories that contribute to the diverse B-1a population.

What functional assays can researchers use to study FCRL6's role in immune regulation?

Researchers can employ several specialized assays to investigate FCRL6's functional roles:

Pre-BCR Formation Analysis:

  • Stain FCRL6+ and FCRL6- pro B cells (AA4.1+CD43+CD19+B220hiIgM-) with anti-pre-BCR (SL156) antibodies

  • Fix cells with Cytofix/Cytoperm buffer and stain with anti-pre-BCR and/or F(ab')2 goat anti-mouse IgM

  • Analyze using flow cytometry to compare pre-BCR formation rates between populations

Apoptosis Assessment:

  • Stain single cells from fetal liver and bone marrow for surface markers

  • Wash in Annexin V binding buffer and stain with anti-Annexin V

  • Compare apoptosis rates between FCRL6+ and FCRL6- populations

Gene Expression Profiling:

  • Isolate FCRL6+ and FCRL6- cells by fluorescence-activated cell sorting

  • Extract RNA and perform quantitative PCR for genes relevant to B cell development

  • Use primers for Iμ, μ0, and Myc to assess transcriptional differences

Differentiation Potential Assays:

  • Culture sorted FCRL6+ and FCRL6- progenitors under B cell differentiation conditions

  • Monitor development, proliferation rates, and phenotypic changes over time

  • Assess generation of different B cell subsets, particularly B-1a cells

VH Repertoire Analysis:

  • Sequence the VH genes from FCRL6+ and FCRL6- progenitors

  • Analyze CDR-H3 sequences for hydrophobicity, charge, and length

  • Compare VH11 and VH12 usage between populations

These assays collectively provide a comprehensive toolkit for examining how FCRL6 influences immune cell development, selection, and function.

What implications does mouse FCRL6 research have for understanding autoimmunity?

Research on mouse FCRL6 provides several important insights into autoimmunity mechanisms:

  • Autoreactive BCR Generation: FCRL6+ progenitors generate μ heavy chains with constrained diversity and autoreactive properties . This suggests FCRL6 may mark a developmental pathway that contributes to the natural autoantibody repertoire, with potential implications for understanding the origins of pathogenic autoantibodies.

  • B-1a Development Regulation: By distinguishing subpopulations with different B-1a developmental potential, FCRL6 research illuminates the origins of B-1a cells , which are known to produce natural IgM antibodies that can react with self-antigens and contribute to autoimmune pathology.

  • Selection Mechanisms: FCRL6 discriminates between pre-BCR dependent and independent selection pathways , providing insights into how autoreactive B cells might escape negative selection during development.

  • Developmental Heterogeneity: The heterogeneous origins of B cells marked by FCRL6 have implications for understanding autoimmunity pathogenesis , suggesting multiple developmental pathways may contribute to the generation of autoimmune-prone B cell populations.

These findings collectively suggest that FCRL6 could serve as an important marker for identifying and studying B cell progenitors with autoimmune potential, offering new targets for therapeutic intervention in autoimmune disorders.

How might findings from mouse FCRL6 research translate to human cancer immunology?

While mouse and human FCRL6 show differences in cellular expression patterns, research findings from mouse models provide valuable insights with translational relevance to human cancer immunology:

Comparison with Human Data:

Immune Checkpoint Implications:
Mouse FCRL6 research reveals details about B cell selection and development that complement human studies showing FCRL6's inhibitory properties similar to established immune checkpoint molecules like LAG3 . This suggests FCRL6 could be a novel target for cancer immunotherapy.

Resistance Mechanisms:
Understanding the basic biology of FCRL6 in mice provides context for human findings that show elevated FCRL6 in melanoma samples from patients who experienced relapse after progression on anti-PD-1 therapy , potentially explaining resistance mechanisms.

These translational connections highlight how fundamental research on mouse FCRL6 can inform our understanding of human cancer immunology and guide the development of new therapeutic approaches.

What are the differences and similarities between mouse and human FCRL6 that researchers should consider?

Understanding the differences and similarities between mouse and human FCRL6 is critical for translational research:

Key Differences:

FeatureMouse FCRL6Human FCRL6
Cellular ExpressionB cell progenitors Cytotoxic NK and T cells
Developmental RoleMarks progenitors with B-1a potential Associated with terminal differentiation of effector cells
Expression in DiseaseNot fully characterized in cancer modelsPrognostic in melanoma, lung, and breast cancer

Important Similarities:

FeatureShared Characteristics
StructureBoth contain extracellular Ig domains that can be expressed as recombinant proteins
RegulationExpression is sensitive to cellular activation
Disease RelevanceBoth implicated in immune regulation with potential roles in cancer and immune disorders
SignalingBoth appear to have regulatory functions in their respective cell populations

Research Considerations:

  • Expression pattern differences mean that mouse models focusing on B cell development may not directly translate to human NK/T cell biology

  • Functional studies should account for the different cellular contexts

  • Despite differences, shared structural features suggest conserved molecular mechanisms

  • The disparate expression patterns may reflect species-specific immune adaptations

  • Comparative studies examining both species can provide complementary insights

These considerations highlight the importance of careful experimental design when using mouse FCRL6 research to inform human applications, while also recognizing the valuable mechanistic insights that can be gained from mouse models.

How can FCRL6 be used to investigate developmental heterogeneity in B cell progenitors?

FCRL6 serves as a powerful tool for investigating B cell progenitor heterogeneity through several experimental approaches:

Developmental Fate Mapping:

  • Isolate FCRL6+ and FCRL6- progenitors from fetal liver and bone marrow

  • Culture under B cell differentiation conditions or transfer into immunodeficient recipients

  • Track developmental outcomes, particularly the generation of B-1a versus conventional B cells

  • This approach can reveal distinct developmental potentials masked in bulk progenitor populations

Transcriptional Profiling:

  • Perform RNA sequencing or targeted gene expression analysis on sorted FCRL6+ versus FCRL6- progenitors

  • Compare expression of genes associated with distinct developmental programs

  • FCRL6+ progenitors exhibit distinct transcript signatures including TCF/LEF and nervous system developmental regulation as well as B-1a related properties

  • These transcriptional differences can identify molecular mechanisms underlying developmental heterogeneity

BCR Repertoire Analysis:

Pre-BCR Signaling Studies:

  • Examine pre-BCR formation and signaling in FCRL6+ versus FCRL6- progenitors

  • Investigate downstream targets like Myc induction

  • These studies can reveal distinct signaling requirements between progenitor subsets

By leveraging FCRL6 as a marker of progenitor heterogeneity, researchers can dissect the diverse developmental pathways that establish the complex B cell compartment, with implications for understanding both normal immune development and disease processes.

What experimental approaches can determine if FCRL6 is a suitable target for immunotherapy?

Evaluating FCRL6 as an immunotherapy target requires a comprehensive experimental strategy:

In Vitro Functional Studies:

  • Generate blocking antibodies against mouse FCRL6 using techniques similar to those described for generating anti-FCRL6 monoclonal antibodies

  • Test effects of FCRL6 blockade on B cell development, selection, and function

  • Assess impacts on pre-BCR signaling and developmental trajectory of FCRL6+ progenitors

  • Compare with parallel studies of human FCRL6 on NK and T cell function

Mouse Tumor Models:

  • Establish syngeneic tumor models in wild-type and FCRL6-deficient mice

  • Evaluate tumor growth kinetics and immune infiltration

  • Test anti-FCRL6 blocking antibodies alone and in combination with established immunotherapies

  • Assess correlation between FCRL6 expression and response to therapy

Mechanistic Studies:

  • Investigate whether FCRL6 functions similarly to established immune checkpoint inhibitors like LAG3

  • Examine FCRL6's role in tumor-immune cell interactions, particularly in MHCII+ tumors

  • Determine if FCRL6 blockade enhances anti-tumor immune responses

  • Evaluate effects on cytotoxic function and cytokine production of tumor-infiltrating lymphocytes

Translational Potential Assessment:

  • Correlate mouse findings with human cancer data showing FCRL6 as a prognostic marker

  • Develop humanized mouse models to test human FCRL6-targeted therapies

  • Establish biomarkers to identify patients likely to respond to FCRL6-targeted therapy

This multi-faceted approach would provide comprehensive evidence regarding FCRL6's suitability as an immunotherapy target, building on existing data showing its prognostic significance in human cancers and potential as an immune checkpoint molecule.

How can researchers leverage FCRL6 to better understand the origins of natural antibodies?

FCRL6 provides a unique opportunity to investigate the developmental origins of natural antibodies through several specialized research approaches:

Lineage Tracing Studies:

  • Generate FCRL6 reporter mice (e.g., FCRL6-GFP knockin) to track FCRL6+ progenitors throughout development

  • Perform fate-mapping experiments to determine which B cell subsets derive from FCRL6+ progenitors

  • Correlate with production of natural antibodies, particularly phosphatidylcholine-specific antibodies

B-1a Development Analysis:

  • Isolate FCRL6+ and FCRL6- progenitors from fetal liver and adult bone marrow

  • Transfer into immunodeficient recipients and track B-1a cell development

  • Compare VH11 versus VH12 B-1a generation from each population

  • Analyze resulting natural antibody profiles in recipient mice

Pre-BCR Dependency Investigation:

  • Study the requirement for pre-BCR formation in natural antibody development

  • Compare VH11 and VH12 B-1a cells, which show differential pre-BCR dependency in FCRL6+ progenitors

  • Manipulate pre-BCR signaling components to determine effects on natural antibody production

Molecular Analysis of Selection Mechanisms:

  • Analyze gene expression profiles during selection of FCRL6+ versus FCRL6- progenitors

  • Identify molecular pathways involved in generating natural antibody-producing B cells

  • Focus on genes differentially expressed between FCRL6+ and FCRL6- cells that relate to BCR signaling and selection

Repertoire Sequencing:

  • Perform deep sequencing of BCR repertoires from FCRL6+ versus FCRL6- derived B cells

  • Analyze patterns of VH usage, N-additions, and CDR-H3 properties

  • Correlate with binding specificities characteristic of natural antibodies

These approaches leverage FCRL6 as a marker to dissect the heterogeneous developmental origins of natural antibody-producing B cells, providing insights into both basic immunology and potential therapeutic applications for autoimmunity and infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.