Recombinant Mouse FERM domain-containing protein 3 (Frmd3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Frmd3; FERM domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Frmd3
Target Protein Sequence
MFASCHCAPRGRRTMKMIHFRSSSIKSLNQEMKCTIRLLDDSEVSCHIQRETKGQFLIEY ICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKSHPPYTMCFRVKFYPHEPLKIK EELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAEFGDYYPDEHPENYISEFEIFP KQSQKLERKIMEIHNNELRGQSPAIAEFNLLLKAHTLETYGVDPHPCKDSRGATAFLGFT AAGFVVFQGNKRIHLRKWSDVCKLKFEGKTFYVIGSQKEKNAVLAFHTSTPAACKHLWKC GVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQRDPPEVHRVNI TQSRSFHSLNKQLIINMEPLQPLLPSPTEQEEEVPVGEGVPLPKMDVSEPLIASSPVKGA QCADPPDEEEDRVKEDPLTISELAYNPSASLLPTPVDDDEINMLFDCPSRLELEREDTDS FEELEADENAFLIAEEEELKEARQALSWSYSILTGHIWVNPLVKSFSRLLVVGLGLLLFV FPLLLLLLESGIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVNIVLYMLGCS
Uniprot No.

Target Background

Function

Putative tumor suppressor gene potentially involved in lung cancer development and progression.

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure of FERM domain-containing protein 3 (Frmd3)?

Frmd3 belongs to the FERM domain-containing protein superfamily, which consists of over 40 proteins. Like other members of this family, Frmd3 contains a three-lobed N-terminal FERM domain that binds various cell membrane-associated proteins and lipids. The FERM domain typically forms a cloverleaf-shaped conformation with three subdomains (F1, F2, and F3) that compact together . The C-terminal region often contains an actin-binding domain, allowing these proteins to mediate linkage between the cell membrane and the actin cytoskeleton . In Frmd3 specifically, the N-terminal ubiquitin-like domain is crucial for protein-protein interactions, particularly with proteins like vimentin .

What are the primary biological functions of Frmd3?

Frmd3 functions primarily as a tumor suppressor in multiple tissue types. In breast cancer, Frmd3 significantly inhibits cell proliferation, migration, and invasion in vitro and suppresses xenograft growth and metastasis in vivo . In mammary epithelial cells, Frmd3 regulates cell fate by functioning as an endogenous activator of the Notch signaling pathway, facilitating basal-to-luminal transformation .

In kidney tissues, Frmd3 appears to play a role in maintaining epithelial cell integrity, with lower levels of expression associated with accelerated fibrotic changes and chronic kidney disease (CKD) progression . Its downregulation leads to increased apoptotic activity and dysregulation of E-cadherin, which is essential for cell-cell adhesion .

How is Frmd3 expression regulated in normal tissues?

While the search results don't specifically address regulation of Frmd3 expression in normal tissues, evidence suggests that Frmd3 levels vary by tissue type and physiological state. In normal mammary epithelial cells, Frmd3 appears to regulate lineage development and stemness . The Human Protein Atlas confirms Frmd3 localization in the normal human nephron, with a wider distribution than just proximal tubular cells .

For experimental purposes, researchers studying Frmd3 regulation would need to design tissue-specific experiments examining transcription factors, epigenetic modifications, and post-transcriptional mechanisms that might control Frmd3 expression in different contexts.

What molecular mechanisms underlie Frmd3's tumor suppressor function in breast cancer?

Frmd3 exerts its tumor suppressor function in breast cancer through multiple molecular mechanisms:

  • Vimentin degradation pathway: Frmd3 interacts with vimentin and ubiquitin protein ligase E3A (UBE3A) to induce polyubiquitin-mediated proteasomal degradation of vimentin. This degradation subsequently downregulates focal adhesion complex proteins and pro-cancerous signaling activation, resulting in cytoskeletal rearrangement and defects in cell morphology and focal adhesion .

  • Notch signaling regulation: Frmd3 functions as an endogenous activator of the Notch signaling pathway in mammary epithelial cells. Mechanistically, Frmd3 promotes the degradation of Disheveled-2 by disrupting its interaction with deubiquitinase USP9x. Additionally, Frmd3 interrupts the interaction of Disheveled-2 with CK1, FOXK1/2, and NICD (Notch intracellular domain), decreasing Disheveled-2 phosphorylation and nuclear localization .

  • Cell lineage control: Loss of Frmd3 in PyMT mice results in a luminal-to-basal transition phenotype, which is associated with more aggressive breast cancers. Single-cell RNA sequencing of mammary epithelial cells indicated that knockout of Frmd3 inhibits the Notch signaling pathway, which is crucial for proper mammary epithelial cell differentiation .

The N-terminal ubiquitin-like domain of Frmd3 is particularly important for its anti-cancer effects, as it's responsible for Frmd3-vimentin interaction through binding the head domain of vimentin. Truncated Frmd3 with deletion of the ubiquitin-like domain almost completely loses its anti-breast cancer effects .

How does Frmd3 contribute to kidney disease pathophysiology?

Evidence suggests that Frmd3 plays a significant role in kidney disease pathophysiology, particularly in diabetic nephropathy and chronic kidney disease progression. Lower levels of Frmd3 expression are associated with accelerated fibrotic changes and CKD progression .

In experimental models, lentiviral-mediated Frmd3 knockdown in human renal proximal tubule epithelial cells leads to:

  • Reduced cell viability

  • Altered metabolic activity and structural markers

  • Increased apoptotic activity

  • Dysregulation of E-cadherin, which is essential for cell-cell adhesion

Genetically, Frmd3 has been associated with diabetic kidney disease in both White and Black individuals, though in the latter population, this association emerged only after accounting for ApoL1 status . The rs1888747 polymorphism in the Frmd3 gene has been studied in relation to diabetic kidney disease and diabetic retinopathy .

What is the relationship between Frmd3 and the Notch signaling pathway?

Frmd3 functions as an endogenous activator of the Notch signaling pathway, particularly in mammary epithelial cells. Single-cell RNA sequencing data indicates that knockout of Frmd3 inhibits the Notch signaling pathway .

The mechanism involves:

  • Disheveled-2 regulation: Frmd3 promotes the degradation of Disheveled-2 by disrupting its interaction with deubiquitinase USP9x.

  • Protein complex disruption: Frmd3 interrupts the interaction of Disheveled-2 with CK1, FOXK1/2, and NICD (Notch intracellular domain).

  • Post-translational modification: Frmd3 decreases Disheveled-2 phosphorylation and nuclear localization.

These molecular interactions ultimately impair Notch-dependent luminal epithelial lineage plasticity in mammary epithelial cells . Interestingly, this represents a paradox in renal fibrogenesis, as renal fibrosis typically involves activation rather than repression of Notch signaling, despite decreased Frmd3 levels being associated with fibrosis .

What are the recommended methods for studying Frmd3 expression in tissues?

Based on current research methodologies, several approaches are recommended for studying Frmd3 expression:

  • RNA-seq and transcriptomic profiling: This approach has been used to identify Frmd3 expression patterns in clinical samples, such as CKD biopsies. RNA-seq can be performed at the bulk tissue, single-cell, or single-nucleus level to provide comprehensive gene expression data .

  • PCR analysis: For genetic polymorphism studies, PCR thermal cycler systems (such as QuantStudio 5 RT-PCR System) can be used. A protocol for analyzing Frmd3 gene polymorphisms involves enzyme activation for 20 seconds at 95°C, followed by 45 cycles at 95°C for 3 seconds and 60°C for 30 seconds .

  • Immunohistochemistry: The Human Protein Atlas confirms Frmd3 localization in various tissues, suggesting immunohistochemical staining as an effective method for protein localization studies .

  • Western blotting: For protein expression level analysis, particularly when comparing Frmd3 levels between different experimental conditions or disease states.

When designing experiments to study Frmd3 expression, researchers should consider tissue heterogeneity and use techniques like laser capture microdissection or single-cell approaches when appropriate to avoid confounding by varying cell type compositions.

What knockout or knockdown approaches have been validated for Frmd3 functional studies?

Several genetic manipulation approaches have been validated for studying Frmd3 function:

  • Lentiviral-mediated knockdown: This approach has been successfully used in human renal proximal tubule epithelial cells to study the effects of Frmd3 depletion on cell viability, metabolic activity, and structural markers .

  • CRISPR/Cas9 knockout: Complete knockout of Frmd3 has been generated in mouse models. In one study, loss of Frmd3 in PyMT mice resulted in a luminal-to-basal transition phenotype in mammary epithelial cells .

  • Overexpression systems: Studies have utilized Frmd3 overexpression to investigate the protein's interactome and functional effects, particularly in cancer models .

When designing knockdown or knockout experiments, researchers should consider:

  • Cell-type specificity: Different cell types may respond differently to Frmd3 manipulation

  • Dosage effects: Complete knockout versus partial knockdown may reveal different aspects of Frmd3 function

  • Compensatory mechanisms: Other FERM domain proteins might compensate for Frmd3 loss

  • Temporal aspects: Inducible systems may be preferable for studying developmental effects

The International Mouse Phenotyping Consortium has generated Frmd3 knockout mouse models that show effects in the eye and on white cell number, though kidney effects have not been specifically examined in these models .

What protein interaction assays are most informative for studying Frmd3 binding partners?

To study Frmd3's protein-protein interactions effectively, researchers have employed several complementary approaches:

  • Co-immunoprecipitation (Co-IP): This method has successfully identified interactions between Frmd3 and binding partners such as vimentin and UBE3A .

  • Interactome analysis: Interactome studies using cellular overexpression systems have provided insights into Frmd3's binding partners, though researchers should be aware that protein overexpression itself may alter the interactome .

  • Structural biology approaches: X-ray crystallography has been used to study the structure of FERM domains (albeit in kindlin-3, not specifically Frmd3), revealing how these domains compact together in a cloverleaf-shaped conformation .

  • Proximity labeling methods: While not explicitly mentioned in the search results, BioID or APEX2-based proximity labeling would be valuable for identifying proteins that interact with Frmd3 in living cells.

  • Domain mapping experiments: Studies have identified specific domains involved in protein interactions, such as the N-terminal ubiquitin-like domain of Frmd3 being responsible for binding to the head domain of vimentin .

When designing interaction studies, researchers should consider both direct and indirect interactions, as well as the possible effects of post-translational modifications on these interactions.

How is Frmd3 expression altered in human diseases?

Frmd3 expression shows significant alterations in several human diseases:

  • Breast cancer: Frmd3 is significantly downregulated in breast cancer clinical tissue and cell lines. Low Frmd3 expression has been closely associated with progressive breast cancer and shortened survival time in patients .

  • Chronic kidney disease: Lower levels of Frmd3 expression are associated with accelerated fibrotic changes and CKD progression. Transcriptomic analyses of CKD biopsies have identified Frmd3 as one of the top-ranking genes correlated with disease progression .

  • Diabetic nephropathy: Frmd3 has been genetically associated with diabetic kidney disease in both White and Black individuals, with specific polymorphisms like rs1888747 being studied in relation to diabetic kidney disease and diabetic retinopathy .

The consistent pattern across these diseases is that reduced Frmd3 expression correlates with worse disease outcomes, supporting its role as a tumor suppressor and tissue homeostasis regulator.

What is the potential of Frmd3 as a biomarker or therapeutic target?

Frmd3 shows promise both as a biomarker and potential therapeutic target:

As a biomarker:

  • In breast cancer, low levels of Frmd3 predict poor outcomes for patients, suggesting its utility as a prognostic marker .

  • In CKD, Frmd3 expression levels correlate with eGFR, percentage tubulointerstitial fibrosis, and disease progression over 5 years, indicating potential as a prognostic biomarker for kidney disease progression .

As a therapeutic target:

  • The tumor suppressor role of Frmd3 in breast cancer suggests that strategies to restore or increase its expression might have therapeutic value .

  • In kidney disease, maintaining or increasing Frmd3 levels might help preserve epithelial cell integrity and reduce fibrosis .

  • Since it's the lower expression of Frmd3 that is associated with poorer outcomes, therapeutic correction would require increasing Frmd3 expression, which is more challenging than inhibiting an overexpressed protein.

  • Strategies might need to focus on suppressing upstream inhibitors or increasing activity of downstream molecules in the Frmd3 pathway.

  • A deeper understanding of the mechanisms regulating Frmd3 expression would be needed to develop effective therapeutics .

What are the differences between mouse and human Frmd3 that researchers should consider?

While the search results don't explicitly detail the differences between mouse and human Frmd3, researchers working with recombinant mouse Frmd3 should consider several important factors when translating findings to human contexts:

  • Sequence and structural homology: Before conducting studies with mouse Frmd3, researchers should compare the sequence homology and structural conservation between mouse and human proteins. This is particularly important for the functional domains like the FERM domain and the N-terminal ubiquitin-like domain, which are critical for Frmd3's interactions with proteins like vimentin .

  • Expression pattern differences: The tissue distribution and expression levels may differ between species. For example, while Frmd3 is expressed in the human nephron , its expression pattern in mouse kidney should be independently verified.

  • Signaling pathway conservation: While the Notch signaling pathway is highly conserved across species, there may be subtle differences in how Frmd3 interacts with this pathway in mice versus humans .

  • Disease model relevance: The PyMT mouse model has been used to study Frmd3's role in mammary cancer , but researchers should validate whether the findings in mouse models accurately reflect human disease processes.

  • Genetic background effects: When using mouse models, researchers should consider how different genetic backgrounds might influence Frmd3 function, particularly in studies of polymorphisms associated with disease risk .

When designing experiments with recombinant mouse Frmd3, these species differences should be taken into account, especially when the goal is to translate findings to human disease contexts.

What are the critical unanswered questions about Frmd3 function?

Several critical questions about Frmd3 function remain unanswered:

  • Causality in disease progression: A major unanswered question is whether Frmd3 downregulation is the root cause or a consequence of other gene dysfunction in diseases like CKD. Determining the true causal relationship would help establish whether Frmd3 is more than just a biomarker for progression .

  • Tissue-specific functions: While Frmd3's roles in breast cancer and kidney disease have been partially characterized, its functions in other tissues remain largely unknown. The International Mouse Phenotyping Consortium data suggests effects in the eye and on white cell number, but these have not been thoroughly investigated .

  • Regulation of Frmd3 expression: The mechanisms controlling Frmd3 expression levels in normal and disease states are poorly understood. Understanding these regulatory mechanisms would be essential for developing therapeutic strategies to modulate Frmd3 levels.

  • Complete interactome characterization: While some binding partners have been identified (vimentin, UBE3A, Disheveled-2), a comprehensive interactome across different cell types would provide deeper insights into Frmd3's multifunctional nature.

  • Role in development: The functions of Frmd3 during embryonic and postnatal development remain largely unexplored, particularly in tissues beyond the mammary gland .

What new methodologies could advance Frmd3 research?

Advancing Frmd3 research would benefit from several emerging methodologies:

  • Advanced genetic models: Development of tissue-specific and inducible Frmd3 knockout/knockin models would allow more precise examination of Frmd3's function in different contexts. Existing mouse models that show effects in the eye and on white cell number should be further examined for kidney phenotypes .

  • Single-cell multi-omics: Integration of single-cell transcriptomics, proteomics, and epigenomics would provide a more comprehensive understanding of how Frmd3 functions within the heterogeneous cellular environments of tissues like the kidney or mammary gland .

  • Advanced imaging techniques: Live-cell imaging combined with fluorescently tagged Frmd3 could reveal dynamic aspects of its subcellular localization and interactions with the cytoskeleton and membrane structures.

  • Cryo-electron microscopy: This could provide detailed structural information about Frmd3's interactions with binding partners like vimentin, Disheveled-2, and membrane components.

  • Computational approaches: Machine learning algorithms applied to large datasets could help identify novel patterns and relationships involving Frmd3 in disease progression and cellular function.

  • Organoid models: Using kidney or mammary organoids to study Frmd3 function would provide a more physiologically relevant context than traditional cell lines .

How might understanding Frmd3 pathways inform novel therapeutic strategies?

Understanding Frmd3 pathways could inform novel therapeutic strategies in several ways:

  • Targeting downstream effectors: Since directly increasing Frmd3 expression might be challenging, targeting downstream molecules in the Frmd3 pathway could be a more feasible approach. For example, in breast cancer, strategies to promote vimentin degradation might mimic the effects of Frmd3 .

  • Modulating Notch signaling: Since Frmd3 functions as an endogenous activator of the Notch signaling pathway, particularly in mammary epithelial cells, Notch pathway modulators might be effective in contexts where Frmd3 is downregulated .

  • Inhibiting pathological protein interactions: Developing small molecules or peptides that disrupt the interaction between Disheveled-2 and USP9x could mimic Frmd3's effect on promoting Disheveled-2 degradation .

  • Epigenetic approaches: If Frmd3 downregulation is found to be mediated by epigenetic mechanisms, epigenetic drugs might be used to restore its expression.

  • Combinatorial therapies: Understanding how Frmd3 pathways intersect with other disease-relevant pathways could inform combination therapies. For example, in kidney disease, combining sodium-glucose cotransporter-2 inhibitors or glucagon-like peptide-1 receptor agonists with Frmd3 pathway modulators might have synergistic effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.