Recombinant Mouse Ferric-chelate reductase 1 (FRRS1)

Shipped with Ice Packs
In Stock

Description

Introduction to FRRS1

Ferric-Chelate Reductase 1 (FRRS1) is an important protein that plays a role in iron metabolism and cellular function. It is encoded by the FRRS1 gene, which in humans is located on chromosome 1p21.2 . The protein is also known by several synonyms including SDR2 and SDFR2, as documented in genomic databases . FRRS1 belongs to a family of reductases involved in iron homeostasis, with specific functions in the reduction of ferric iron (Fe³⁺) to ferrous iron (Fe²⁺), a critical step in cellular iron uptake and utilization.

The study of recombinant mouse FRRS1 has provided valuable insights into iron metabolism pathways that are conserved across mammalian species. Understanding the structure and function of this protein is essential for elucidating its role in normal physiology and potential contributions to disease states related to iron dysregulation.

Protein Structure

FRRS1 is a membrane-associated protein that contains specific domains for metal ion binding . While the detailed three-dimensional structure of mouse FRRS1 has not been fully characterized, comparative analysis with related proteins suggests it contains conserved domains typical of ferric reductases. These likely include transmembrane regions anchoring the protein to cellular membranes and catalytic domains responsible for electron transfer during the reduction of ferric iron.

Functional Domains

Based on its classification and function, mouse FRRS1 is expected to contain:

  1. Metal-binding domains that facilitate interaction with iron ions

  2. Electron transfer components essential for reduction reactions

  3. Membrane-binding regions that localize the protein to appropriate cellular compartments

These structural elements work together to enable FRRS1's role in iron metabolism and cellular homeostasis.

Expression Systems

Recombinant mouse FRRS1 production typically employs mammalian expression systems to ensure proper folding and post-translational modifications of this membrane-associated protein. Common approaches include:

  1. Cloning of the mouse FRRS1 gene into expression vectors containing appropriate promoters

  2. Transfection into mammalian cell lines such as HEK293 or CHO cells

  3. Addition of affinity tags (His, GST, or FLAG) to facilitate purification

Purification Methods

Purification of recombinant mouse FRRS1 presents challenges typical of membrane proteins. Strategies often include:

  1. Detergent-based membrane solubilization

  2. Affinity chromatography using tagged constructs

  3. Size exclusion chromatography for final purification

For research applications, recombinant FRRS1 may be produced with various tags depending on the intended use, including immunological detection or functional studies.

Role in Iron Homeostasis

The primary function of FRRS1 relates to intracellular iron ion homeostasis, as indicated by gene ontology annotations . In particular, comparative studies in dogs have confirmed FRRS1's involvement in intracellular iron ion homeostasis pathways . This function is critical for maintaining appropriate iron levels within cells, as both iron deficiency and excess can have deleterious effects on cellular function.

Cellular Localization

FRRS1 is primarily localized to cellular membranes , consistent with its proposed role in iron transport and metabolism. This membrane association is essential for facilitating the movement of iron between cellular compartments and potentially across the plasma membrane.

Comparison Between FRRS1 and FRRS1L

An important distinction must be made between FRRS1 and the related protein FRRS1L (Ferric-Chelate Reductase 1 Like). While they share similar nomenclature, they appear to have distinct functions and tissue distribution.

Neurological Relevance

While FRRS1L has been extensively characterized for its role in the central nervous system and AMPA receptor regulation , traditional FRRS1 appears to have primarily metabolic functions related to iron homeostasis. In contrast to FRRS1L, which shows significant expression in neurons and affects glutamatergic synaptic transmission , standard FRRS1 has not been specifically implicated in direct regulation of neurotransmitter receptors based on the available research.

Research Tools

Recombinant mouse FRRS1 serves as an important tool for various research applications:

  1. Production of specific antibodies for detection and localization studies

  2. Substrate for in vitro enzymatic assays examining ferric reductase activity

  3. Protein-protein interaction studies to identify binding partners

Antibody Production

Commercial antibodies against mouse FRRS1 have been developed for research purposes. These antibodies enable detection of the protein in mouse tissues and cell lines through techniques such as Western blotting, immunohistochemistry, and ELISA. The availability of recombinant mouse FRRS1 has facilitated the development and validation of these important research reagents.

Role in Disease States

Emerging research suggests potential connections between FRRS1 and various pathological conditions. Gene ontology associations indicate a possible link between FRRS1 orthologs and COVID-19 , although the precise mechanism remains to be elucidated. This connection warrants further investigation, particularly regarding how iron metabolism might influence viral pathogenesis.

Future Research Opportunities

Several research directions for recombinant mouse FRRS1 show promise:

  1. Structural studies to determine the precise three-dimensional configuration

  2. Comprehensive characterization of enzymatic activities and metal specificity

  3. Investigation of potential roles in oxidative stress responses

  4. Exploration of tissue-specific functions in mouse models

  5. Examination of interactions with other proteins involved in iron homeostasis

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
FRRS1; Sdfr2; Sdr2; Ferric-chelate reductase 1; Stromal cell-derived receptor 2; SDR-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-592
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
FRRS1
Target Protein Sequence
MAAPQITLSVLVIALLTCSVTAYPNGKVPMSCGGMIPQHNHSPQSEPIHQITVSQTTFKP GDQIEVTLSGPPFRGFLLEARDAENLSGPPIGSFTLIDSEESQLLTCTDVQGLAVSHTRS SKKTEIKVYWDAPSPAPDHIRFLATVVQKFKIYWVKIPSPVISQPNAPPFTTPKATTQPL TTPPSVSHLTKPFSAFECGNKKFCVRSPLNCDPEKEPACVFLSFTRDNQSVMVEMSGPSD GYVSFAFSHDQWMGDDDAYLCIREDQTVDIQPSYLTGRSYPVMDSRGTLEDMAWRLADGV IQCSFRRNITLPEAKNRFVLNESYYIFFAEGPSHDGRIFRHSQQPLITYEKYNVTDTPKS VGGSRSSPLLKAHGALMFVAWMTTVSIGVLVARFFRSVWSKAFFLREAAWFQVHRMLMVA TSLLTCVAFVLPFVYRGGWSWRAGYHPYLGCTVMTLAVLQPLLATFRPPLHDPRRQVFNW THWSVGTAARIIAVAAMFLGMDLPGLNLPSPQKTYAMMGFVVWHIGTEVILEIHAYRLSR KVEILDNDRIQILQSLTVAEAEGHVFKKVVLAVYICGNVIFLSIFLSAINHI
Uniprot No.

Target Background

Function
Ferric-chelate reductases play a crucial role in reducing Fe(3+) to Fe(2+) prior to its transport from the endosome to the cytoplasm.
Gene References Into Functions
  1. Research indicates that four members of the b561 family of predicted ferric reductases, namely mouse cytochrome b561, human duodenal cytochrome b, and mouse stromal cell-derived receptor 2, exhibit ferric reductase activity. PMID: 14499595
Database Links
Protein Families
FRRS1 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in spleen, liver and kidney with low expression in brain. Localizes in adult brain to the choroid plexus of the fourth, third, and lateral ventricles and to ependymal cells that line the ventricles.

Q&A

What is FRRS1L and what is its primary function in the brain?

FRRS1L (Ferric Chelate Reductase 1 Like protein, also known as C9orf4) is a protein component of native AMPA receptor (AMPAR) complexes in the brain. Recent proteomic studies have identified FRRS1L as part of these receptor complexes, suggesting it plays a key role in synaptic transmission. FRRS1L functions primarily as an auxiliary subunit that regulates AMPAR-mediated excitatory synaptic transmission, with knockout studies demonstrating its importance in maintaining proper AMPAR expression at the neuronal surface .

How does FRRS1L interact with AMPA receptors at the molecular level?

FRRS1L associates with AMPA receptors through direct interactions with both GluA1 and GluA2 subunits, as demonstrated by co-immunoprecipitation (Co-IP) assays in HEK293T cells. Unlike some other receptor-associated proteins, FRRS1L does not form dimers or oligomers when expressed in heterologous cells. In mouse hippocampal neurons, recombinant FRRS1L at the neuronal surface partially co-localizes with GluA1 and primarily localizes at non-synaptic membranes .

Where is FRRS1L expressed in the mouse brain?

FRRS1L is expressed in the mouse brain, with particularly notable expression in the hippocampus. At the subcellular level, native FRRS1L in the hippocampus localizes specifically to dynein-containing vesicles but is absent from kinesin5B vesicles. This differential localization suggests a potential role in retrograde transport of AMPARs, which may be critical for maintaining appropriate receptor levels at synapses .

How does knockout of FRRS1L affect AMPA receptor function and what are the observed phenotypes?

Single-cell knockout of FRRS1L produces significant functional deficits in AMPAR-mediated synaptic transmission. Specifically:

ParameterWild-typeFRRS1L KnockoutStatistical Significance
Surface GluA1 expressionNormalStrongly reducedp<0.01
AMPAR-mediated synaptic transmissionNormalSignificantly decreasedp<0.01
Grip strength (all limbs)NormalReduced (remains significant after correcting for weight)3 months: p<0.05; 6 months: p<0.05; 9 months: p<0.01
Motor coordination (rotarod)NormalShorter latency to fallp<0.05
Complex wheel runningNormalUnable to run with missing rungsp<0.001
HyperactivityNormalIncreased distance and velocityp<0.01
Sleep duration (dark phase)NormalReducedp=0.0002
Sleep bout length (dark phase)NormalReducedp=0.00001
Cued fear conditioningNormalDeficitsNot specified

These data indicate that FRRS1L knockout produces a developmental, non-progressive phenotype featuring motor coordination deficits, hyperactivity, and learning impairments that closely mirror symptoms observed in human patients with FRRS1L mutations .

What are the molecular mechanisms by which FRRS1L regulates AMPA receptor function?

FRRS1L appears to regulate AMPA receptor function through control of receptor maturation and surface expression. When FRRS1L is knocked out, there is a dramatic reduction in GluA1 subunit expression at the neuronal surface. This suggests that FRRS1L may be involved in either the forward trafficking of AMPARs to the cell surface, stabilization of AMPARs at the membrane, or protection from degradation. The protein's presence in dynein-containing vesicles but not kinesin5B vesicles further suggests a role in retrograde transport mechanisms that may be critical for AMPAR recycling or maintenance .

How do FRRS1L mutations in humans correlate with neurological disorders?

Loss-of-function mutations in FRRS1L in humans lead to a devastating neurological condition characterized by epilepsy, choreoathetosis (involuntary movements), and severe cognitive deficits. The mouse model lacking FRRS1L shows phenotypes that parallel these human symptoms, including hyperactivity, motor coordination deficits, and learning impairments. This suggests that the fundamental role of FRRS1L in regulating AMPAR function is conserved between species, and disruption of this function leads to similar neurological consequences across mammals .

What are the preferred methods for studying FRRS1L-AMPAR interactions in vitro?

Co-immunoprecipitation (Co-IP) assays in heterologous cell systems such as HEK293T cells represent an effective approach for studying FRRS1L-AMPAR interactions in vitro. The methodology includes:

  • Co-transfection of tagged FRRS1L (e.g., HA-FRRS1L) with tagged AMPAR subunits (e.g., Flag-GluA1 or Flag-GluA2) into HEK cells

  • Cell lysis 48 hours post-transfection using appropriate lysis buffer

  • Immunoprecipitation using anti-tag antibodies (e.g., anti-Flag)

  • Washing beads with lysis buffer

  • Elution in loading buffer containing β-mercaptoethanol

  • SDS-PAGE resolution followed by immunoblotting with appropriate antibodies

This approach allows researchers to examine whether FRRS1L directly interacts with specific AMPAR subunits and to characterize the nature of these interactions .

What techniques are effective for studying FRRS1L function in neurons?

Multiple complementary techniques have proven effective for studying FRRS1L function in neurons:

  • Single-cell knockout using CRISPR/Cas9: This allows for targeted deletion of FRRS1L in individual neurons while maintaining wild-type neurons as internal controls

  • Electrophysiology: Patch-clamp recordings to measure AMPAR-mediated synaptic currents

  • Immunocytochemistry: To visualize FRRS1L localization relative to synaptic markers

  • Surface biotinylation assays: To quantify changes in surface expression of AMPAR subunits

  • Subcellular fractionation: To determine FRRS1L association with specific cellular compartments

These methodologies, when combined, provide a comprehensive understanding of FRRS1L's role in regulating AMPAR function and synaptic transmission in neuronal contexts .

How can researchers effectively model FRRS1L deficiency in mice for behavioral studies?

Researchers can effectively model FRRS1L deficiency using knockout mice (Frrs1l−/−) generated through techniques such as gene trapping. When conducting behavioral studies with these models, several specialized tests have proven informative:

  • Grip strength testing: Measures neuromuscular function using a grid connected to a force gauge

  • Horizontal ladder challenge (Locotronic): Assesses fine motor coordination and gait

  • Rotarod test: Measures motor coordination and balance

  • Wheel-running paradigm: Tests motor ability and adaptation to complex challenges

  • Open field test: Evaluates general locomotor activity and anxiety-related behaviors

  • Fear conditioning paradigm: Assesses learning and memory formation

  • Home cage monitoring: Analyzes activity patterns and sleep behaviors

These tests collectively provide a comprehensive behavioral profile that can reveal the functional consequences of FRRS1L deficiency across multiple domains of neurological function .

How should researchers interpret contradictory findings regarding FRRS1L overexpression versus knockout effects?

A critical finding in FRRS1L research is that overexpression of the protein in hippocampal neurons does not change glutamatergic synaptic transmission, while knockout strongly reduces AMPAR-mediated synaptic transmission. This apparent contradiction should be interpreted in the context of protein function saturation and compensatory mechanisms.

What controls are essential when designing experiments investigating FRRS1L function in neurons?

When designing experiments to investigate FRRS1L function in neurons, several essential controls should be included:

  • For transfection/transduction studies: Empty vector controls that undergo identical treatment

  • For CRISPR/Cas9 knockout studies: Non-targeting gRNA controls to account for potential off-target effects

  • For immunocytochemistry: Secondary antibody-only controls and staining in knockout tissue to verify antibody specificity

  • For co-localization studies: Appropriate markers to distinguish between synaptic and non-synaptic membranes

  • For behavioral studies: Both wild-type littermates and heterozygous animals to establish dose-dependency of phenotypes

Additionally, when interpreting results, researchers should consider the developmental timing of FRRS1L manipulation, as early developmental versus acute adult manipulation may yield different phenotypes due to the potential role of FRRS1L in synaptic development .

How can researchers differentiate between direct effects of FRRS1L on AMPARs versus indirect effects through other pathways?

Differentiating between direct and indirect effects of FRRS1L on AMPARs requires a multi-pronged experimental approach:

  • Biochemical interaction studies: Co-IP and proximity labeling approaches in both heterologous cells and neurons to confirm direct physical interactions

  • Structure-function analyses: Creation of FRRS1L mutants with specific domain deletions to identify critical regions for AMPAR interaction

  • Temporal manipulation: Acute versus chronic manipulation of FRRS1L levels to distinguish developmental from maintenance roles

  • Rescue experiments: Determine whether wild-type FRRS1L can rescue knockout phenotypes while interaction-deficient mutants cannot

  • Parallel assessment of other pathways: Evaluate changes in other signaling pathways that might indirectly influence AMPAR function

The current evidence suggests direct effects of FRRS1L on AMPARs through protein-protein interactions, but careful experimental design is necessary to rule out potential indirect mechanisms .

How do findings from mouse FRRS1L studies translate to understanding human neurological disorders?

Findings from mouse FRRS1L studies have direct translational relevance to human neurological disorders. Loss-of-function mutations in human FRRS1L lead to a syndrome characterized by epilepsy, choreoathetosis, and severe cognitive impairment. The mouse knockout model displays remarkably similar phenotypes, including motor coordination deficits, hyperactivity, and learning impairments.

This phenotypic conservation between species strongly suggests that the fundamental molecular mechanisms by which FRRS1L regulates AMPAR function are preserved across mammals. Consequently, mechanistic insights gained from mouse models are likely applicable to human pathology. The non-progressive nature of the phenotype in mice also aligns with clinical observations in humans, suggesting that FRRS1L plays a critical role during development that, when disrupted, leads to persistent neurological dysfunction .

What therapeutic approaches might target FRRS1L-related synaptic dysfunction?

Based on current understanding of FRRS1L function, several therapeutic approaches might be considered for FRRS1L-related disorders:

  • Gene therapy approaches: Introduction of functional FRRS1L in early development might prevent the emergence of neurological symptoms

  • AMPAR modulators: Positive allosteric modulators of AMPARs might partially compensate for reduced surface expression

  • Trafficking enhancers: Compounds that enhance forward trafficking of AMPARs might bypass the requirement for FRRS1L

  • Symptom-specific approaches: Targeted treatments for epilepsy, movement disorders, and cognitive dysfunction based on downstream effects

What are the key unanswered questions regarding FRRS1L function and regulation?

Despite significant advances in understanding FRRS1L, several key questions remain unanswered:

  • What is the precise mechanism by which FRRS1L regulates AMPAR surface expression?

  • Does FRRS1L play different roles during development versus in mature neurons?

  • Are there specific AMPAR subunit compositions that are preferentially regulated by FRRS1L?

  • What other proteins interact with FRRS1L to mediate its effects on AMPARs?

  • How is FRRS1L expression and function itself regulated during normal development and in disease states?

Addressing these questions will require integrated approaches combining molecular, cellular, and systems neuroscience techniques to build a comprehensive understanding of FRRS1L's role in brain function .

What novel methodologies might advance research on FRRS1L and related proteins?

Several emerging methodologies hold promise for advancing FRRS1L research:

  • Cryo-electron microscopy: To determine the 3D structure of FRRS1L alone and in complex with AMPARs

  • Optogenetic control of FRRS1L: To enable temporally precise manipulation of its function

  • Single-molecule imaging: To track FRRS1L and AMPAR trafficking in real-time in living neurons

  • Transcriptomics and proteomics in FRRS1L-deficient neurons: To identify compensatory mechanisms and downstream effectors

  • Human iPSC-derived neurons from patients with FRRS1L mutations: To study human-specific aspects of FRRS1L function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.