Recombinant Mouse Fetal and adult testis-expressed transcript protein homolog (Fate1)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

Recombinant Mouse FATE1 is produced via heterologous expression systems, often with affinity tags for purification.

Host/Expression SystemTagPurity (%)ApplicationsSource
E. coliHis-Tag>80%Structural studies, ELISA
HEK-293 CellsStrep-Tag>90%Functional assays, WB
Cell-Free Protein Synthesis (CFPS)Myc-Tag70–80%ELISA, SDS-PAGE

Key Notes:

  • His-Tagged variants (e.g., Cat.# RFL21631MF) enable nickel-affinity purification .

  • Strep-Tagged proteins (AA 1-183) are used for high-purity applications .

Research Applications and Functional Insights

FATE1’s recombinant form has been pivotal in uncovering its biological roles.

Apoptosis Regulation

FATE1 inhibits apoptosis by:

  • Reducing Ca²⁺ uptake in mitochondria, limiting fragmentation .

  • Collaborating with RNF183 to degrade pro-apoptotic BIK protein .

Study FocusMethodologyOutcomeSource
Apoptosis SensitivitysiRNA knockdown in cancer cell lines>30% viability reduction; caspase-3/7 activation
ER-Mitochondria CouplingProteolysis assays, MAM fractionationFATE1 modulates ER-mitochondria distance

Mitochondrial Dynamics

FATE1 promotes mitochondrial hyperfusion by:

  • Interacting with Mfn2 (mitofusin-2) fusion machinery .

  • Resisting fragmentation under apoptotic stimuli (e.g., TNF, valinomycin) .

MechanismImpact on MitochondriaExperimental EvidenceSource
Mfn2 InteractionHyperfusion maintenanceCo-IP, Mfn2/Mfn1 knockout studies
ER-Mitochondria DistanceReduced Ca²⁺ transfer, apoptosis resistanceLive-cell imaging, Ca²⁺ flux assays

Challenges and Limitations

  • Functional Studies: Recombinant FATE1’s activity in vitro remains unvalidated .

  • Host Dependency: Localization and stability may vary between E. coli and mammalian systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Fate1; Fate; Fetal and adult testis-expressed transcript protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fate1
Target Protein Sequence
MPWVPREHSHDDVQLQEFSRNFPVGRFPYECLEADIMAKIGLEELNGLEMEVMRRQMQMT SGRLHILEDQDATWCHKEAALFTLLVSVCIANLWLWVHW
Uniprot No.

Target Background

Function
Fate1 plays a crucial role in regulating endoplasmic reticulum (ER)-mitochondria coupling. It negatively regulates the ER-mitochondria distance and Ca2+ transfer from the ER to mitochondria, potentially influencing apoptotic regulation. Fate1 may cooperate with RNF183 to control BIK protein levels, thereby regulating apoptotic signaling.
Database Links

UniGene: Mm.99811

Subcellular Location
Mitochondrion. Mitochondrion outer membrane. Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

How does mouse FATE1 compare to human FATE1 in terms of expression and function?

While human FATE1 was initially identified as a cancer-testis antigen (CTA) in hepatocellular carcinomas and gastric and colon cancers, mouse FATE1 shares similar functional properties . Both human and mouse FATE1 are predominantly expressed in testis and adrenal glands, with some expression in other tissues including lungs, heart, kidneys, and brain .

Functionally, both proteins are localized in mitochondria-associated ER membranes (MAM) and modulate ER-mitochondria distance to regulate calcium-dependent and drug-induced apoptosis . This conservation of function makes mouse models valuable for studying FATE1's role in human cancers, particularly in understanding mechanisms of chemoresistance.

What is the normal expression pattern of FATE1 in mouse tissues during development and adulthood?

FATE1 shows a distinct developmental expression pattern. In mouse fetuses, it is testis-specific during early development (equivalent to the 6-11 week period in human development) . In adult mice, FATE1 expression is predominantly detected in the testis and adrenal glands, with lower levels of expression in the lungs, heart, kidneys, and brain .

This tissue-specific expression pattern is significant for researchers, as it suggests FATE1 may have specialized functions in reproductive and endocrine tissues. The restricted normal expression contrasts with its widespread detection in various cancer cell lines, making it a potential biomarker and therapeutic target .

What are the optimal techniques for detecting and quantifying mouse FATE1 expression?

For reliable detection and quantification of mouse FATE1, researchers should employ a combination of techniques:

  • Western Blotting: Using commercially available recombinant FATE1 proteins (such as His-tagged versions) as positive controls. The recombinant protein with a molecular weight of approximately 11.7 kDa can serve as a size reference .

  • Immunohistochemistry/Immunofluorescence: For tissue localization studies, focusing particularly on testis, adrenal glands, and tumor samples.

  • qRT-PCR: For mRNA expression analysis, designing primers that specifically target mouse FATE1 to avoid cross-reactivity with related family members.

  • SDS-PAGE: For protein purity assessment and molecular weight confirmation .

For subcellular localization studies, confocal microscopy with markers for ER and mitochondria is recommended to visualize FATE1's position at the ER-mitochondria interface .

How should recombinant mouse FATE1 protein be handled and stored for experimental reliability?

Based on standard protocols for recombinant proteins similar to the one described in the product datasheet:

  • Storage conditions: Store at -80°C for long-term storage and avoid repeated freeze-thaw cycles by aliquoting the protein solution.

  • Working temperature: Keep on ice during experiments and use within a few hours after thawing.

  • Buffer compatibility: When designing experiments, consider that the recombinant FATE1 protein is likely purified in a specific buffer that may affect experimental outcomes .

  • Quality control: Before use, verify protein purity via SDS-PAGE (should be >90% as indicated for recombinant preparations) .

  • Stability concerns: As FATE1 contains a transmembrane domain, it may have limited stability in solution. Consider adding appropriate detergents or stabilizers if aggregation occurs.

What cell models are most appropriate for studying mouse FATE1 function?

The choice of cell model should be guided by the specific research question:

  • Cancer studies: Cell lines derived from adrenocortical carcinoma (ACC) are particularly relevant, as FATE1 expression is controlled by steroidogenic factor-1 (SF-1) in these cells .

  • Apoptosis mechanisms: H295R cells with inducible FATE1 expression systems have proven valuable for studying FATE1's role in apoptosis resistance .

  • Calcium signaling: Cell models that allow for calcium imaging (such as those amenable to Fura-2 loading) are recommended for studying FATE1's impact on calcium dynamics .

  • Drug resistance: Non-small-cell lung cancer cell lines that naturally express FATE1 are useful for studying chemoresistance, particularly to paclitaxel .

When establishing new models, researchers should consider using inducible expression systems (such as Dox-inducible) to control FATE1 expression levels and timing, which helps distinguish acute versus chronic effects .

How does FATE1 regulate ER-mitochondria distance and calcium signaling?

FATE1 acts as a physical spacer between the endoplasmic reticulum and mitochondria, modulating their proximity and consequently calcium transfer between these organelles. Experimental evidence shows:

  • Physical tethering mechanism: FATE1 localizes at the interface between ER and mitochondria, specifically enriched in the mitochondria-associated ER membranes (MAM) fraction .

  • Distance regulation: FATE1 expression increases the distance between ER and mitochondria, while its knockdown decreases this distance .

  • Calcium transfer impairment: By increasing the ER-mitochondria distance, FATE1 expression reduces calcium transfer from ER to mitochondria, which can be measured using calcium indicators .

This mechanism has significant implications for mitochondrial calcium homeostasis, which in turn affects multiple cellular processes including apoptosis, mitochondrial metabolism, and mitochondrial dynamics .

What is FATE1's role in apoptosis regulation and how can this be experimentally demonstrated?

FATE1 has a protective effect against calcium-dependent apoptotic stimuli through the following mechanisms:

  • Reduced mitochondrial calcium overload: By decreasing calcium transfer from ER to mitochondria, FATE1 prevents mitochondrial calcium overload during stress conditions .

  • Decreased mitochondrial fragmentation: FATE1 expression leads to reduced mitochondrial fragmentation, which is associated with apoptosis resistance .

This anti-apoptotic role can be experimentally demonstrated through:

  • Apoptosis assays: FATE1 expression significantly decreases caspase-3/7 activity after H₂O₂ and C₂-ceramide treatment, which are stimuli that require ER-mitochondria calcium transfer to induce apoptosis .

  • TUNEL analysis: Flow cytometric TUNEL analysis confirms the protective effect of FATE1 expression against H₂O₂- and C₂-ceramide-induced apoptosis .

  • Stimulus specificity: Importantly, FATE1 does not protect against staurosporine-induced apoptosis, which operates through a different mechanism, demonstrating the specificity of FATE1's protective effect to calcium-dependent apoptotic pathways .

How does FATE1 contribute to chemoresistance in cancer models?

FATE1's role in chemoresistance has been demonstrated in several cancer models:

  • Sensitization through silencing: Silencing the FATE1 gene sensitizes non-small-cell lung cancer cell lines to paclitaxel, a common chemotherapeutic drug .

  • Mitotane resistance: In adrenocortical carcinoma models, FATE1 expression significantly decreases apoptosis induced by mitotane (o,p'-DDD), a cornerstone of therapy in advanced ACC .

  • Mechanism of resistance: This chemoresistance likely stems from FATE1's ability to uncouple ER and mitochondria, thereby preventing calcium-dependent apoptotic signaling that many chemotherapeutic drugs rely on .

For researchers studying chemoresistance mechanisms, these findings suggest that targeting the ER-mitochondria interface and specifically FATE1 could be a strategy to overcome drug resistance in tumors expressing this protein.

How should researchers address contradictory findings about FATE1's prognostic significance across different cancer types?

Contradictory findings regarding FATE1's prognostic value require careful methodological consideration:

  • Cancer-specific effects: While elevated FATE1 levels are associated with higher mortality rates in colorectal cancers, in non-small-cell lung cancers, FATE1 elevation alone does not decrease survival chances, but does when RNF183 expression is also increased . This suggests context-dependent roles.

  • Co-expression analysis: Researchers should conduct comprehensive co-expression analyses of FATE1 with other potential interacting partners (such as RNF183) rather than studying FATE1 in isolation .

  • Multivariate analysis: When evaluating prognostic significance, use multivariate analyses that account for confounding factors such as tumor stage, treatment history, and other molecular markers.

  • Tissue-specific regulation: Consider that FATE1 may be regulated differently across tissue types. For instance, in adrenocortical carcinoma, FATE1 is regulated by SF-1, which may not be the case in other cancers .

  • Statistical approach: When analyzing multiple datasets or performing sequential hypothesis testing, consider correction methods such as α-debt to control for inflated error rates .

What methodologies are recommended for studying the interaction between FATE1 and drug resistance mechanisms?

To rigorously investigate FATE1's role in drug resistance, researchers should consider:

  • Dose-response experiments: Conduct systematic dose-response studies with chemotherapeutic agents in cells with modulated FATE1 expression. For mitotane studies in ACC, use concentrations within the therapeutic window (14-20 mg/l) .

  • Temporal considerations: Assess both acute and chronic effects of FATE1 modulation on drug sensitivity using inducible expression systems.

  • Combination approaches: Test whether FATE1 inhibition can sensitize cells to lower doses of chemotherapeutics, potentially reducing side effects while maintaining efficacy.

  • Mechanism dissection: Utilize calcium imaging in combination with mitochondrial function assays to determine if FATE1-mediated chemoresistance operates primarily through calcium signaling disruption.

  • In vivo validation: Extend findings from cell culture to mouse xenograft models, comparing tumor growth and response to chemotherapy between FATE1-expressing and FATE1-silenced tumors.

When publishing results from these experiments, researchers should be aware of potential false positive accumulation in sequential analyses of the same dataset and consider appropriate statistical correction methods such as α-debt or α-spending .

How can researchers effectively integrate FATE1 studies with broader cancer metabolism research?

FATE1's position at the ER-mitochondria interface suggests important connections to metabolic regulation. Researchers should:

  • Mitochondrial function assessment: Beyond calcium signaling, investigate how FATE1 affects mitochondrial respiration, ATP production, and redox balance using techniques such as Seahorse analysis and redox-sensitive probes.

  • Metabolic profiling: Conduct metabolomic analyses to identify metabolic signatures associated with FATE1 expression or silencing, particularly focusing on pathways that might be affected by altered calcium signaling.

  • Integration with cancer metabolic pathways: Examine how FATE1-mediated changes in mitochondrial function interact with known cancer metabolic adaptations, such as the Warburg effect or glutamine addiction.

  • Therapeutic implications: Investigate whether metabolic inhibitors (e.g., mitochondrial function modulators) might synergize with FATE1 inhibition to overcome cancer cell resistance.

  • Sequential experimental design: When conducting multiple related experiments on the same biological samples, consider the statistical implications of sequential hypothesis testing and implement appropriate correction procedures to avoid false positive inflation .

What emerging technologies might enhance FATE1 research in mouse models?

Several cutting-edge approaches could significantly advance our understanding of FATE1:

  • CRISPR-Cas9 genome editing: Generation of FATE1 knockout or knock-in mouse models to study systemic effects of FATE1 modulation, particularly in cancer development and progression.

  • Super-resolution microscopy: Application of techniques like STORM or PALM to visualize the precise localization of FATE1 at the ER-mitochondria interface at nanometer resolution.

  • Calcium nanosensors: Development of targeted calcium sensors to specifically measure calcium concentrations at the ER-mitochondria interface in relation to FATE1 expression.

  • Single-cell approaches: Implementation of single-cell transcriptomics and proteomics to understand cell-to-cell variability in FATE1 expression and its consequences for drug resistance within heterogeneous tumors.

  • Optogenetic tools: Creation of light-controllable FATE1 variants to temporally regulate ER-mitochondria distance with high precision.

When implementing these technologies, researchers should be mindful of statistical considerations, particularly when conducting multiple analyses on the same dataset, and employ appropriate correction methods to maintain proper control of false discovery rates .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.