Recombinant Mouse Fibronectin type III domain-containing protein 9 (Fndc9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Fndc9; Fibronectin type III domain-containing protein 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fndc9
Target Protein Sequence
MNIEVGNVSHTGAIISWSPSEPCLEDYYHIMYRPNWNSIFSGYLRYNFHHEEKVPRTITS VALEHLAPSTLYFLCISCKKAAFPYSHYCTMFHTLDKSPLAAGGSLVDPQISLWVLMAIL LACFTAVLAFICLQFWCLRCHEPRWSYRAGQMEEANGLVRWPEETPALGQREEDLQGFPL EELPRKNSGARAKAEPEAEAIQDALEVVALAREIGNQPAILPHYRE
Uniprot No.

Target Background

Database Links

KEGG: mmu:320116

UniGene: Mm.154358

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Fndc9 and where is it expressed in mice?

Fndc9 (fibronectin type III domain-containing protein 9) is a 224-amino acid protein containing fibronectin type III domains, which are structural motifs characteristic of the fibronectin protein family . These domains are involved in protein-protein interactions that mediate adhesion, migration, differentiation, and proliferation of cells .

Fndc9 is expressed in multiple tissues, with notable presence in cartilaginous structures, smaller blood vessels, and smooth muscle of the gastrointestinal and respiratory tracts . The expression pattern suggests potential roles in tissue development, structural integrity, and cell signaling pathways.

What phenotypes are associated with Fndc9 knockout in mice?

Fndc9 knockout mice (Fndc9 tm1.1(KOMP)Vlcg/Fndc9 tm1.1(KOMP)Vlcg) display a diverse range of phenotypes affecting multiple physiological systems, demonstrating the multifunctional nature of this protein. The following table summarizes the observed phenotypic changes:

Phenotypic CategorySpecific Observations
MusculoskeletalDecreased bone mineral content, Decreased grip strength
Body CompositionDecreased lean body mass, Increased total body fat amount
Immune FunctionDecreased lymphocyte cell number, Increased neutrophil cell number
BehaviorDecreased thigmotaxis, Hyperactivity
ReproductionFemale infertility, Male infertility
Blood ChemistryIncreased circulating alkaline phosphatase level, Increased circulating bilirubin level, Increased mean platelet volume

These phenotypes highlight the importance of Fndc9 in maintaining normal physiological function across multiple systems, particularly in bone metabolism, body composition, immune regulation, and reproductive capacity .

How does the fibronectin type III domain structure influence Fndc9 function?

The fibronectin type III (FNIII) domain is a protein module of approximately 90 amino acids that adopts a β-sandwich structure. In Fndc9, this domain significantly influences protein function through:

Approximately 20.09% of the Fndc9 sequence is predicted to be disordered, which may provide additional functional flexibility to the protein .

What are the best methods for expressing and purifying recombinant mouse Fndc9?

For successful expression and purification of recombinant mouse Fndc9, researchers should consider the following methodological approach:

  • Expression System Selection:

    • Mammalian expression systems (HEK293 or CHO cells) are recommended for proper folding and post-translational modifications

    • E. coli systems may be suitable for isolated domains but risk improper folding of the complete protein

  • Vector Design:

    • Include a cleavable affinity tag (His6 or GST) for purification

    • Incorporate a signal peptide for secretion if using mammalian expression

    • Consider codon optimization for the expression system

  • Purification Protocol:

    • Initial capture using affinity chromatography based on the incorporated tag

    • Secondary purification by ion exchange chromatography

    • Final polishing step using size exclusion chromatography

    • Buffer optimization to maintain protein stability (typically PBS with 5-10% glycerol)

  • Quality Control:

    • SDS-PAGE and western blotting to confirm size and identity

    • Mass spectrometry to verify sequence integrity

    • Circular dichroism to assess proper folding

    • Activity assays to confirm functional integrity

This approach maximizes yield while ensuring the recombinant protein maintains native conformation and functional activity.

How can researchers effectively design knockdown experiments to study Fndc9 function?

When designing knockdown experiments to investigate Fndc9 function, consider these methodological guidelines:

  • Selection of Knockdown Strategy:

    • siRNA/shRNA approach: Design 3-4 target sequences against different regions of Fndc9 mRNA

    • CRISPR-Cas9 approach: Design guide RNAs targeting early exons to ensure complete loss of function

    • Conditional knockdown systems: Consider temporal control using inducible promoters if embryonic lethality is suspected

  • Experimental Design:

    • Include appropriate controls: scrambled siRNA/shRNA, non-targeting guide RNA

    • Validate knockdown efficiency using qRT-PCR and western blot analysis

    • Establish dose-response relationships for knockdown reagents

    • Account for potential off-target effects through comprehensive transcriptome analysis

  • Phenotypic Analysis:

    • Based on known knockout phenotypes, focus on bone mineral density, body composition, and immune cell profiling

    • Include behavioral assessments (activity monitoring, grip strength testing)

    • Analyze reproductive capacity and fertility markers

    • Measure blood chemistry parameters (alkaline phosphatase, bilirubin)

  • Rescue Experiments:

    • Re-express Fndc9 using knockdown-resistant constructs to confirm specificity

    • Utilize domain-specific mutants to identify critical functional regions

This systematic approach ensures robust data generation and meaningful interpretation of Fndc9 function in cellular and physiological contexts.

What immunoassay approaches can detect endogenous versus recombinant Fndc9?

Differentiating between endogenous and recombinant Fndc9 requires strategic immunoassay design:

  • Antibody Selection:

    • For total Fndc9 detection: Use antibodies against conserved epitopes in FNIII domains

    • For recombinant protein-specific detection: Develop antibodies against tag sequences or junction regions unique to the recombinant construct

  • Western Blot Protocol:

    • Sample preparation: Include phosphatase inhibitors to preserve potential PTM sites

    • Separation: Use 10-12% SDS-PAGE gels for optimal resolution

    • Detection: Compare migration patterns (recombinant proteins often show slight size differences)

    • Quantification: Utilize fluorescent secondary antibodies for precise quantification

  • ELISA Development:

    • Sandwich ELISA using capturing antibodies against conserved regions and detection antibodies against unique tags

    • Competitive ELISA to measure displacement of labeled recombinant protein by endogenous protein

    • Standard curve generation using purified recombinant protein for accurate quantification

  • Immunohistochemistry Considerations:

    • Double staining with anti-Fndc9 and anti-tag antibodies to differentiate expression patterns

    • Include proper controls: wild-type tissue, Fndc9 knockout tissue, and tissues from mice expressing tagged Fndc9

These approaches enable precise detection and quantification of both endogenous and recombinant Fndc9 in diverse experimental contexts.

How does Fndc9 contribute to bone metabolism and what are the molecular mechanisms involved?

Fndc9 appears to play a significant role in bone metabolism, as evidenced by decreased bone mineral content in knockout mice . The underlying molecular mechanisms likely involve:

  • Osteoblast Regulation:

    • Fndc9 may influence osteoblast differentiation through interaction with extracellular matrix components

    • The FNIII domains potentially interact with integrins on osteoblast surfaces, modulating adhesion and signaling

    • These interactions could affect downstream pathways including MAPK and Wnt signaling cascades

  • Bone Remodeling:

    • Increased circulating alkaline phosphatase levels in Fndc9 knockout mice suggest altered bone turnover

    • This elevation may represent a compensatory response to impaired bone formation

    • The ratio of bone formation to resorption likely favors the latter in the absence of Fndc9

  • Metabolic Influence:

    • The observed changes in body composition (decreased lean mass, increased fat mass) in knockout mice suggest Fndc9 may influence bone metabolism indirectly through metabolic pathways

    • This could involve crosstalk between adipose tissue and bone through factors such as leptin or adiponectin

  • Proposed Research Approach:

    • Histomorphometric analysis of bone samples from wildtype and Fndc9-deficient mice

    • Primary osteoblast and osteoclast cultures to assess cell-autonomous effects

    • Quantification of bone turnover markers in serum samples

    • Transcriptomic and proteomic profiling of bone tissue to identify affected signaling pathways

Understanding these mechanisms could identify Fndc9 as a potential therapeutic target for metabolic bone disorders.

What is the relationship between Fndc9 expression and immune function?

The immune phenotype of Fndc9 knockout mice reveals important connections between this protein and immune regulation:

  • Lymphocyte and Neutrophil Homeostasis:

    • Fndc9 knockout mice exhibit decreased lymphocyte numbers concurrent with increased neutrophil counts

    • This inverse relationship suggests Fndc9 may regulate myeloid versus lymphoid lineage commitment or survival

  • Potential Signaling Mechanisms:

    • FNIII domains are known to interact with cellular receptors including integrins, which are crucial for immune cell migration and function

    • Structural analyses of related fibronectin domains indicate these interactions can modulate cytokine signaling pathways

    • The specific CC′ loop structure observed in FNIII domains may create binding interfaces for immune regulators

  • Experimental Evidence Supporting Immune Function:

    • The altered immune cell composition in knockout mice parallels expression patterns in tissues with significant immune surveillance requirements

    • Similar fibronectin domains play roles in wound healing and tissue remodeling processes that involve immune activation

  • Research Methodology to Further Investigate:

    • Flow cytometric profiling of major immune cell populations in primary and secondary lymphoid organs

    • Functional assays including cytokine production, proliferation, and migration

    • Challenge models (infection, inflammation) to assess dynamic immune responses

    • Single-cell RNA sequencing to identify cell type-specific effects of Fndc9 deficiency

These findings suggest Fndc9 may function at the intersection of structural tissue organization and immune regulation, potentially through modulating the tissue microenvironment that supports proper immune cell development and function.

What structural features distinguish Fndc9 from other fibronectin type III domain-containing proteins?

Fndc9 possesses distinctive structural characteristics that differentiate it from other FNIII domain-containing proteins:

  • Domain Organization and Interfaces:

    • Similar to the EIIIB domain of fibronectin, Fndc9 likely exhibits specific bending angles between adjacent domains that influence molecular function

    • Based on structural studies of related FNIII domains, Fndc9 may have rotational angles of approximately 60-65° between domains

    • These conformational characteristics create unique interaction surfaces for binding partners

  • Loop Structures:

    • The CC′ loop region is particularly important in FNIII domains, with sequence variations like AGEGIP versus NGQQGN creating distinct binding specificities

    • Fndc9's specific loop sequences likely create unique electrostatic and hydrophobic properties that determine binding partner specificity

  • Intrinsically Disordered Regions:

    • Approximately 20.09% of Fndc9's sequence is predicted to be disordered

    • These disordered regions provide conformational flexibility that may be crucial for function

    • The distribution of disordered regions relative to structured domains contributes to Fndc9's functional uniqueness

  • Post-Translational Modifications:

    • Fndc9 contains at least one documented PTM site

    • The nature and position of this modification site may regulate protein-protein interactions and signaling functions

  • Mutation Patterns:

    • The 52 documented mutations in Fndc9 create potential functional variations

    • The distribution of these mutations relative to domain boundaries and functional motifs provides insight into structure-function relationships

Structural biology approaches including X-ray crystallography, cryo-EM, and small-angle X-ray scattering would be valuable for resolving Fndc9's three-dimensional structure and comparing it to other FNIII domain-containing proteins to further elucidate its unique features.

How does Fndc9 contribute to both male and female fertility?

Fndc9 knockout mice exhibit both male and female infertility , suggesting critical roles in reproductive function across sexes:

  • Female Reproductive Impact:

    • Potential mechanisms include:

      • Ovarian function: Fndc9 may influence folliculogenesis and oocyte maturation

      • Uterine receptivity: FNIII domains often mediate cell-cell and cell-matrix interactions crucial for implantation

      • Hormonal regulation: The metabolic phenotype of knockout mice suggests potential endocrine disruption

  • Male Reproductive Impact:

    • Possible mechanisms include:

      • Spermatogenesis: Fndc9 may regulate germ cell development or Sertoli cell function

      • Sperm maturation: FNIII domains could influence sperm transit through the epididymis

      • Sperm capacitation or fertilization: Cell-surface interactions mediated by FNIII domains are critical for these processes

  • Common Mechanisms:

    • Structural support: Fibronectin domains provide essential extracellular matrix components in reproductive tissues

    • Signaling: FNIII domains interact with integrins and other receptors that activate pathways required for gametogenesis

    • Immune regulation: The altered immune profile in knockout mice may affect the immunological environment of reproductive tissues

  • Research Methodology to Investigate Reproductive Functions:

    • Histological analysis of reproductive tissues from wildtype and knockout mice at different developmental stages

    • Hormone profiling (LH, FSH, estradiol, testosterone) in serum samples

    • Gamete quality assessments including oocyte maturation status and sperm parameters

    • In vitro fertilization experiments to identify specific fertilization defects

The dual infertility phenotype positions Fndc9 as a potential target for understanding shared mechanisms of male and female reproductive function.

What embryonic developmental processes might involve Fndc9?

Based on knowledge of fibronectin type III domains and related proteins, Fndc9 likely participates in several critical developmental processes:

  • Tissue Morphogenesis:

    • FNIII domains in related proteins are expressed during embryogenesis and play roles in tissue patterning

    • Fndc9 may provide essential scaffolding and signaling functions during organ formation

    • The spatial and temporal regulation of Fndc9 expression would inform its developmental functions

  • Cell Migration and Differentiation:

    • Fibronectin domains guide cell migration through interaction with cell surface receptors

    • These interactions influence cellular differentiation pathways, particularly in mesenchymal lineages

    • Fndc9 could modulate neural crest migration, a process requiring precise extracellular matrix interactions

  • Vascular Development:

    • Related FNIII-containing proteins are found in blood vessel walls

    • Fndc9 may contribute to angiogenesis and vascular stability during development

    • The protein could mediate interactions between endothelial cells and surrounding tissues

  • Skeletogenesis:

    • The decreased bone mineral content in knockout mice suggests a role in skeletal development

    • Fndc9 might influence chondrocyte differentiation or function during endochondral ossification

    • Expression in cartilaginous structures supports this developmental role

  • Research Approaches to Investigate:

    • Temporal expression analysis throughout embryonic development using RNA-seq and protein localization

    • Lineage tracing in developmental models combined with conditional Fndc9 deletion

    • Ex vivo organ culture systems to assess tissue-specific effects

    • Embryonic stem cell differentiation models to evaluate cell-autonomous functions

Understanding Fndc9's developmental roles could provide insights into congenital disorders affecting multiple organ systems, particularly those involving skeletal, vascular, and reproductive abnormalities.

What disease models might benefit from Fndc9 modulation?

Based on the phenotypic profile of Fndc9 knockout mice and the known functions of FNIII domain-containing proteins, several disease models could benefit from Fndc9 modulation:

  • Metabolic Disorders:

    • The altered body composition (decreased lean mass, increased fat mass) in knockout mice suggests Fndc9 modulation could impact:

      • Obesity models: Targeting Fndc9 might influence fat deposition patterns

      • Metabolic syndrome: The protein may affect the relationship between adiposity and metabolic parameters

      • Sarcopenia: Fndc9 modulation could preserve lean mass during aging or disease

  • Skeletal Disorders:

    • Decreased bone mineral content in knockout mice indicates potential applications in:

      • Osteoporosis models: Fndc9 agonists might enhance bone formation

      • Fracture healing: The protein could promote appropriate matrix organization during repair

      • Skeletal developmental disorders: Modulation might correct abnormal bone formation

  • Inflammatory Conditions:

    • The altered immune cell profile (decreased lymphocytes, increased neutrophils) suggests relevance to:

      • Chronic inflammatory disorders: Fndc9 modulation could restore immune homeostasis

      • Wound healing models: The protein may promote appropriate tissue remodeling

      • Fibrotic conditions: Controlling extracellular matrix organization through Fndc9 might prevent pathological fibrosis

  • Reproductive Disorders:

    • Infertility in both male and female knockout mice indicates potential applications in:

      • Models of unexplained infertility

      • Implantation failure

      • Germline development disorders

  • Experimental Approaches:

    • Administer recombinant Fndc9 or domain-specific peptides in disease models

    • Develop small molecule modulators of Fndc9-protein interactions

    • Use gene therapy approaches to restore or enhance Fndc9 expression in targeted tissues

These therapeutic applications would require detailed understanding of tissue-specific functions and potential off-target effects before clinical translation.

How do post-translational modifications affect Fndc9 function and potential therapeutic applications?

Post-translational modifications (PTMs) of Fndc9 likely create a complex regulatory network that influences its function:

  • Identified PTM Sites:

    • At least one documented PTM site has been identified in Fndc9

    • Based on related proteins, potential modifications may include:

      • Phosphorylation: Regulating protein-protein interactions and signaling functions

      • Glycosylation: Affecting stability, localization, and binding partner recognition

      • Ubiquitination: Controlling protein turnover and subcellular targeting

  • Functional Consequences:

    • PTMs likely modulate:

      • Protein conformation and domain orientation

      • Binding affinity for interaction partners

      • Subcellular localization and secretion efficiency

      • Proteolytic processing and turnover rates

  • Disease Relevance:

    • Dysregulation of Fndc9 PTMs could contribute to:

      • Bone metabolism disorders through altered signaling

      • Immune dysfunction via modified interaction with immune receptors

      • Reproductive disorders through disrupted tissue organization or signaling

  • Therapeutic Implications:

    • PTM-directed therapeutic strategies might include:

      • Inhibitors of specific kinases that phosphorylate Fndc9

      • Modulators of glycosylation enzymes that modify the protein

      • Compounds that stabilize specific PTM states to prolong desired functions

      • Engineered recombinant Fndc9 variants with modified PTM sites

  • Research Methodology:

    • Mass spectrometry-based proteomics to map all PTM sites

    • Site-directed mutagenesis to create PTM-deficient variants

    • Functional assays comparing wild-type and PTM-modified Fndc9

    • In vivo studies using knock-in mice expressing PTM-variant Fndc9

Understanding the PTM landscape of Fndc9 would enable more precise therapeutic targeting and provide insight into regulatory mechanisms that could be exploited for disease intervention.

What are the current technical limitations in studying Fndc9 and how might they be overcome?

Several technical challenges currently limit comprehensive Fndc9 research:

  • Protein Production and Purification:

    • Challenge: Obtaining correctly folded, post-translationally modified recombinant Fndc9

    • Solutions:

      • Optimize expression in mammalian systems with appropriate chaperones

      • Develop domain-specific expression constructs for structural studies

      • Employ advanced purification techniques like affinity chromatography combined with size exclusion

  • Antibody Specificity:

    • Challenge: Limited availability of highly specific antibodies for different epitopes or modified forms

    • Solutions:

      • Generate monoclonal antibodies against multiple epitopes

      • Develop modification-specific antibodies for PTM studies

      • Validate antibodies using knockout tissues and multiple detection methods

  • Structural Characterization:

    • Challenge: Determining the three-dimensional structure, particularly domain interfaces

    • Solutions:

      • Apply cryo-EM for full-length protein structure

      • Use X-ray crystallography for individual domains

      • Employ hydrogen-deuterium exchange mass spectrometry for dynamic structural information

  • Tissue-Specific Functions:

    • Challenge: Delineating roles in different tissues

    • Solutions:

      • Generate conditional knockout models with tissue-specific Cre drivers

      • Develop reporter systems to track expression patterns during development

      • Employ single-cell approaches to identify cell-specific expression and effects

  • Interaction Partners:

    • Challenge: Identifying physiologically relevant binding partners

    • Solutions:

      • Apply proximity labeling techniques (BioID, APEX) in relevant cell types

      • Use cross-linking mass spectrometry to capture transient interactions

      • Develop domain-specific interaction screening approaches

Addressing these technical limitations will require interdisciplinary approaches combining structural biology, molecular genetics, and systems biology to fully elucidate Fndc9's functions and therapeutic potential.

What emerging technologies could advance our understanding of Fndc9 biology?

Several cutting-edge technologies hold promise for revolutionizing Fndc9 research:

  • Advanced Structural Biology Approaches:

    • AlphaFold and other AI-driven structure prediction tools to model Fndc9 domains and interactions

    • Single-particle cryo-EM for visualization of dynamic conformational states

    • Integrative structural biology combining multiple data sources (SAXS, NMR, XL-MS) for comprehensive structural characterization

  • Genome Editing Technologies:

    • CRISPR-based precise genomic modifications to create:

      • Domain-specific mutations

      • Fluorescent protein fusions at endogenous loci

      • Conditional alleles for temporal control

    • Base editing and prime editing for introducing subtle mutations to study structure-function relationships

  • Spatial Transcriptomics and Proteomics:

    • Spatial transcriptomics to map Fndc9 expression in tissue context

    • Imaging mass spectrometry for spatial distribution of Fndc9 and its modified forms

    • Multiplexed ion beam imaging (MIBI) to simultaneously visualize multiple proteins in tissue sections

  • Single-Cell Multiomics:

    • Single-cell RNA-seq to identify cell populations expressing Fndc9

    • Single-cell ATAC-seq to determine chromatin accessibility at the Fndc9 locus

    • Integrated single-cell multi-omic approaches to correlate Fndc9 expression with cellular phenotypes

  • Organoid and Microphysiological Systems:

    • Organ-on-chip models to study Fndc9 function in tissue-specific contexts

    • 3D organoids to investigate developmental roles

    • Bioprinted tissues incorporating labeled Fndc9 to track protein dynamics

  • Computational Approaches:

    • Network biology to position Fndc9 within functional pathways

    • Molecular dynamics simulations to predict conformational changes

    • Machine learning models to predict functional consequences of mutations

These emerging technologies, particularly when used in combination, have the potential to overcome current limitations and provide unprecedented insights into Fndc9 biology across multiple scales from molecular interactions to physiological functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.