Recombinant Mouse Formyl peptide receptor-related sequence 3 (Fpr-rs3)

Shipped with Ice Packs
In Stock

Description

Ligand Specificity and Cellular Distribution

  • Agonist Response: Unlike mFpr1 and mFpr2, Fpr-rs3 shows poor activation by bacterial formyl peptides (e.g., fMLF) and synthetic agonists like WKYMVm or Compound 43 .

  • Intracellular Localization: Fpr-rs3 exhibits constitutive internalization, localizing intracellularly rather than on the plasma membrane .

Comparative Analysis of Mouse FPR Subtypes

ReceptorAgonist PreferenceCellular DistributionHuman Ortholog
mFpr1fMLF, fMIFL, synthetic peptidesPlasma membraneFPR1
mFpr2F2L (acetylated peptide)Plasma membraneFPR2/ALX
mFpr-rs3Minimal response to tested agonistsIntracellular compartmentsFPR3

Data from binding assays and degranulation studies in transfected RBL-2H3 cells .

Research Applications

Recombinant Fpr-rs3 is critical for:

  • Ligand-Binding Studies: Used in saturation/competition assays to map receptor-ligand interactions .

  • Immune Signaling: Investigates roles in detecting pathogen-associated molecular patterns (PAMPs) and damage-associated molecular patterns (DAMPs) .

  • Neuroscience: Transgenic Fpr-rs3-i-Venus mouse models enable optical identification and electrophysiological analysis of vomeronasal sensory neurons (VSNs) .

Key Research Findings

  • Electrophysiological Properties: Fpr-rs3-expressing VSNs show no distinct biophysical differences compared to non-expressing neurons, suggesting its function is ligand-specific rather than ion channel-modulatory .

  • Gene Expression Dynamics: Transgenic studies reveal transient Fpr-rs3 expression in immature VSNs, with spatial segregation in the vomeronasal neuroepithelium .

  • Commercial Availability: Products include recombinant proteins (e.g., CSB-BP527121MO1) and tagged ORF clones (e.g., MR218059) for in vitro studies .

Future Directions

Current research gaps include:

  • Identifying high-affinity endogenous ligands for Fpr-rs3.

  • Elucidating its role in bridging immune and neuroendocrine responses .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Fpr-rs3; Formyl peptide receptor-related sequence 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fpr-rs3
Target Protein Sequence
MEANSSIPLNGSEVVFYDSTTSRVLWILSVIVLSITFVLGVLGNGLVIWVAGFRMAHTVT TICYLNLALGDFSFMVTLPLHIISMVMKGKWLFGWFLCKFVLSIVHINLFVSVFLITLIA MDRCTCVLHPVWVQNHRTVSLARKVIVGAWILSLLLTLPHFLFLTTVRDARGEVHCTCNF ESVVANPEEQLKVSITVSTATGIISFIIGFSLPMSFIAVCYGLMAAKICRKGFLNSSRPL RVLTAVAISFFMCWFPFQLIILLGNIWNKETPSSIHILLNPASTLASFNSCLNPILYVFL GQEFREKLIYSLSASLERALREDSVLSSGKSSNFSSCPADSEL
Uniprot No.

Target Background

Function
May have an olfactory function associated with the identification of pathogens or pathogenic states.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed exclusively in vomeronasal neurons. Expressed in 0.8 % of a subset of sensory neurons located in the apical layer of the vomeronasal organ. Localized in sensory somata as well as dendritic cells. Each neuron appears to express only one receptor

Q&A

How should recombinant Fpr-rs3 be stored for optimal stability?

For optimal stability of recombinant Fpr-rs3, the protein should be stored at -20°C for regular storage needs. For extended storage periods, conserving the protein at -20°C or -80°C is recommended. The shelf life depends on several factors including buffer ingredients, storage temperature, and the inherent stability of the protein itself.

Generally, liquid form recombinant Fpr-rs3 has a shelf life of approximately 6 months when stored at -20°C/-80°C, while the lyophilized form can maintain stability for up to 12 months under the same storage conditions. It's important to note that repeated freezing and thawing cycles should be avoided to prevent protein degradation. For working aliquots that will be used within a short timeframe, storage at 4°C for up to one week is acceptable .

What expression systems are typically used for producing recombinant Fpr-rs3?

Based on available research data, recombinant mouse Fpr-rs3 is typically produced using in vitro E. coli expression systems. This bacterial expression system offers several advantages for producing recombinant transmembrane proteins like Fpr-rs3, including high yield, cost-effectiveness, and relatively straightforward purification procedures.

The E. coli system allows for the expression of the full-length protein (1-343) with appropriate tagging (typically an N-terminal 10xHis-tag) to facilitate downstream purification and experimental applications. While mammalian expression systems might provide more native post-translational modifications, the E. coli system appears to be the predominant choice for basic research applications involving recombinant Fpr-rs3 .

What are the passive membrane properties of Fpr-rs3-expressing neurons?

Fpr-rs3-expressing neurons exhibit specific passive membrane properties that have been characterized through electrophysiological recordings. Studies using transgenic Fpr-rs3-i-Venus mice have revealed the following key parameters:

  • Membrane capacitance (Cmem): Fpr-rs3+ neurons show an average Cmem value of 5.96 ± 0.49 pF (n = 21), which is similar to control vomeronasal sensory neurons (VSNs) at 5.24 ± 0.38 pF (n = 21).

  • Input resistance (Rinput): Fpr-rs3+ neurons exhibit extraordinarily high input resistance, averaging 3.15 ± 0.49 GΩ (n = 21), comparable to control VSNs (3.29 ± 0.43 GΩ; n = 21). This high Rinput suggests that even small receptor currents (picoampere range) can trigger action potential discharge.

  • Membrane time constant (τmem): Fpr-rs3+ neurons display relatively slow time constants of 26.79 ± 2.25 ms (n = 21) versus 24.29 ± 1.57 ms (n = 21) in control neurons.

These passive electrical properties do not significantly differ from the general VSN population, indicating that Fpr-rs3 expression does not create a distinct biophysical phenotype in terms of passive membrane properties .

How do Fpr-rs3-expressing neurons respond to current injection?

Fpr-rs3-expressing neurons demonstrate characteristic active membrane responses to current injection that have been documented through patch-clamp recordings. Key response characteristics include:

  • Action potential threshold: Fpr-rs3+ neurons exhibit extraordinary sensitivity, with depolarizing current injections of just 2-24 pA being sufficient to trigger repetitive action potential discharge.

  • Spontaneous activity: Fpr-rs3+ neurons display spontaneous firing at 2.37 ± 0.54 Hz (n = 19), which is slightly lower but not significantly different from control VSNs (3.9 ± 1.08 Hz; n = 21).

  • Frequency coding range: These neurons show a relatively narrow spike frequency coding range, with maximum firing rates (fmax) of 14.5 ± 0.88 Hz (n = 19), compared to 16.54 ± 1.17 Hz (n = 21) in control VSNs. The f-I curve reveals response saturation at current inputs greater than 20 pA.

  • Hyperpolarization response: Upon negative current injection, Fpr-rs3+ neurons exhibit a characteristic hyperpolarization-activated rebound depolarization ("sag"), indicative of Ih currents and HCN channel expression. This sag potential becomes apparent at membrane potentials more negative than -75 mV, with rebound spikes frequently observed upon repolarization.

These firing properties suggest that Fpr-rs3+ neurons, like other VSNs, are tuned for high sensitivity but have a restricted dynamic range for encoding stimulus intensity .

What are the action potential characteristics of Fpr-rs3-expressing neurons?

Fpr-rs3-expressing neurons exhibit distinctive action potential waveforms with the following quantitative characteristics:

  • Spike amplitude: Fpr-rs3+ neurons generate action potentials with an average amplitude of 72.24 ± 0.97 mV (n = 134), comparable to 73.92 ± 0.87 mV (n = 172) in control neurons.

  • Action potential kinetics:

    • Time-to-peak (TTP): 2.29 ± 0.06 ms for Fpr-rs3+ cells versus 2.33 ± 0.09 ms for controls

    • Full duration at half-maximum (FDHM): 3.65 ± 0.08 ms for Fpr-rs3+ neurons versus 3.67 ± 0.12 ms for control VSNs

These measurements reveal that Fpr-rs3+ neurons generate relatively slow action potentials with waveform parameters that do not significantly differ from control VSNs. The slow action potential kinetics correlate with the relatively narrow spike frequency coding range observed in these neurons, suggesting specialized temporal coding properties that may reflect the functional role of these neurons in processing specific sensory information .

What are the characteristics of voltage-gated sodium currents in Fpr-rs3-expressing neurons?

Fpr-rs3-expressing neurons exhibit specific voltage-gated sodium (Nav) current properties that contribute to their action potential generation capabilities:

  • Activation threshold: Tetrodotoxin (TTX)-sensitive Nav currents in Fpr-rs3+ neurons show an activation threshold of approximately -65 mV.

  • Current density: The maximum Nav current density in these neurons is -136.7 ± 14.1 pA/pF (n = 10), which is comparable to control VSNs (-157.5 ± 17.4 pA/pF; n = 20).

  • Activation kinetics: Nav currents in Fpr-rs3+ neurons display relatively slow activation kinetics with a time-to-peak of 1.86 ± 0.10 ms (n = 10) at a test potential of -30 mV.

These Nav current properties align with the relatively slow action potential firing observed in Fpr-rs3+ neurons. The data indicate that while Fpr-rs3+ neurons possess the fundamental machinery for action potential generation, their sodium channel kinetics may be specialized for the sensory processing functions unique to vomeronasal neurons .

How can transgenic mouse models be utilized for studying Fpr-rs3 function?

Transgenic mouse models provide powerful tools for investigating the physiological roles of Fpr-rs3. The Fpr-rs3-i-Venus mouse strain represents an effective approach with the following methodological considerations:

  • Reporter system design: These transgenic mice are engineered to co-express Fpr-rs3 with a fluorescent marker (Venus), enabling optical identification of Fpr-rs3-expressing neurons in acute tissue preparations.

  • Experimental applications:

    • Acute VNO tissue slice preparation for electrophysiological recordings

    • Single-neuron patch-clamp analysis for characterizing biophysical properties

    • Calcium imaging of identified Fpr-rs3+ neurons in response to potential ligands

    • Morphological analysis of Fpr-rs3+ neuron distribution and projections

  • Validation approach: Comparative electrophysiological characterization between Fpr-rs3+ (fluorescently labeled) and control neurons confirms that transgene expression does not perturb the basic biophysical properties of these neurons, validating the model for physiological studies.

This transgenic approach allows researchers to overcome the challenge of identifying specific receptor-expressing neurons within heterogeneous neural populations, making it possible to study Fpr-rs3 function in the neurons' native environment without altering their fundamental properties .

What is the physiological significance of Fpr-rs3's high input resistance and narrow dynamic range?

The extraordinary high input resistance (approximately 3.15 GΩ) and narrow spike frequency coding range (0-15 Hz) of Fpr-rs3-expressing neurons have important physiological implications:

  • Signal sensitivity: The high input resistance ensures that even minimal receptor currents (a few picoamperes) are sufficient to trigger action potential discharge. This property makes Fpr-rs3+ neurons exquisitely sensitive to their specific ligands, allowing detection of low-concentration stimuli.

  • Signal-to-noise considerations: This high sensitivity necessitates careful gain/offset control mechanisms to prevent false-positive output. Research suggests that the primary signal transduction machinery in Fpr-rs3+ neurons must be precisely balanced to maintain detection specificity.

  • Temporal integration: The relatively long membrane time constant (τmem ≈ 25 ms) ensures that brief stimulatory events will not generate significant output. This aligns with the understanding that stimulus exchange in the vomeronasal organ (VNO) is relatively slow, likely allowing prolonged receptor-ligand interaction.

  • Coding capacity: The narrow dynamic range (linear range even narrower than the 0-15 Hz total range) suggests these neurons are specialized for detecting the presence or absence of specific ligands rather than encoding a wide concentration range. This binary detection strategy may be optimal for processing the discrete chemical signals typically detected by the vomeronasal system .

How do the biophysical properties of Fpr-rs3-expressing neurons compare to other vomeronasal sensory neurons?

Comparative analysis of Fpr-rs3-expressing neurons and other vomeronasal sensory neurons reveals important similarities and functional implications:

ParameterFpr-rs3+ NeuronsControl VSNsFunctional Significance
Membrane capacitance5.96 ± 0.49 pF5.24 ± 0.38 pFSimilar signal propagation characteristics
Input resistance3.15 ± 0.49 GΩ3.29 ± 0.43 GΩEqually high sensitivity to input signals
Membrane time constant26.79 ± 2.25 ms24.29 ± 1.57 msSimilar temporal integration properties
Spontaneous activity2.37 ± 0.54 Hz3.9 ± 1.08 HzComparable baseline activity levels
Maximum firing rate14.5 ± 0.88 Hz16.54 ± 1.17 HzSimilar narrow dynamic encoding range
Na+ current density-136.7 ± 14.1 pA/pF-157.5 ± 17.4 pA/pFComparable action potential generation machinery

The remarkable similarities in biophysical properties between Fpr-rs3+ neurons and the general VSN population suggest that Fpr-rs3 expression does not confer a distinct electrophysiological phenotype. Instead, these neurons appear to share the fundamental signal processing machinery common to the vomeronasal system, with specificity likely arising from receptor expression rather than intrinsic electrical properties. This suggests that vomeronasal FPR-expressing neurons are integrated into the general VSN population rather than forming a functionally segregated subsystem .

What are the key methodological approaches for studying Fpr-rs3 in acute tissue preparations?

When investigating Fpr-rs3 in acute tissue preparations, researchers should consider the following methodological approaches:

  • Tissue preparation:

    • Use transgenic Fpr-rs3-i-Venus mice for optical identification of Fpr-rs3+ neurons

    • Prepare acute VNO tissue slices (typically 250-300 μm thick)

    • Maintain tissue in physiological solution with appropriate oxygenation

  • Electrophysiological recording:

    • Employ whole-cell patch-clamp techniques with pipette resistances of 6-8 MΩ

    • Use current-clamp configuration for analyzing action potential generation and passive membrane properties

    • Apply voltage-clamp protocols for isolating specific ion conductances (e.g., TTX-sensitive Na+ currents)

  • Analysis parameters:

    • Determine passive properties immediately after membrane rupture

    • Measure membrane capacitance using square pulse routines (e.g., 5 mV, 10 ms)

    • Calculate input resistance from steady-state voltage responses to defined current steps

    • Determine membrane time constant from monoexponential fits to voltage responses

    • Analyze action potential parameters from the first spike of a train

  • Pharmacological approaches:

    • Use tetrodotoxin (TTX) to isolate Na+ currents

    • Apply other channel blockers to dissect specific conductances contributing to neuronal excitability

These methodological considerations enable detailed characterization of Fpr-rs3+ neurons in their native environment while allowing comparison with non-expressing neurons in the same preparation, providing insight into both the specific properties of Fpr-rs3+ neurons and their integration within the broader sensory system .

What quality control measures should be implemented when working with recombinant Fpr-rs3?

When working with recombinant Fpr-rs3 protein, implementing rigorous quality control measures is essential for experimental reproducibility:

  • Protein validation:

    • Verify protein identity through mass spectrometry or Western blotting using anti-His tag or specific anti-Fpr-rs3 antibodies

    • Confirm protein purity using SDS-PAGE and size exclusion chromatography

    • Validate proper folding through circular dichroism or limited proteolysis assays

  • Storage and handling:

    • Divide purified protein into single-use aliquots to avoid repeated freeze-thaw cycles

    • Store at -20°C for regular use or at -80°C for extended storage

    • For working solutions, maintain aliquots at 4°C for maximum one week

    • Document protein concentration, buffer composition, and pH for all preparations

  • Functional assessment:

    • Implement ligand binding assays to confirm biological activity

    • If incorporating into artificial membranes or liposomes, verify proper membrane integration

    • Consider using fluorescence-based assays to monitor conformational changes upon ligand binding

  • Documentation:

    • Maintain detailed records of expression batch, purification protocol, and storage conditions

    • Document any modifications (tags, mutations) that may affect protein function

    • Include appropriate positive and negative controls in all functional assays

These quality control measures help ensure that experimental outcomes reflect the true properties of Fpr-rs3 rather than artifacts introduced by protein degradation or improper handling .

How is Fpr-rs3 being investigated in relationship to neural circuit function?

Current research on Fpr-rs3 is expanding beyond single-neuron characterization to explore its role in neural circuit function:

  • Circuit mapping approaches:

    • Anterograde and retrograde tracing from identified Fpr-rs3+ neurons

    • Trans-synaptic labeling to identify downstream targets

    • Functional connectivity analysis using channelrhodopsin-assisted circuit mapping

  • Behavioral correlates:

    • Conditional knockout or silencing of Fpr-rs3+ neurons to assess behavioral consequences

    • Optogenetic activation of Fpr-rs3+ neurons to determine sufficiency for triggering specific behaviors

    • Correlation of Fpr-rs3+ neuron activity with social, reproductive, or defensive behaviors

  • Integration with other sensory systems:

    • Investigation of potential cross-talk between the vomeronasal and main olfactory systems

    • Exploration of how Fpr-rs3 signals integrate with information from V1R/V2R-expressing neurons

    • Examination of how Fpr-rs3-mediated signals are processed in higher brain regions

These research directions aim to establish the functional significance of Fpr-rs3 expression in the broader context of chemosensory processing and behavioral output, moving beyond the biophysical characterization of individual neurons to understand their role in complex neural circuits .

What are the challenges in identifying physiological ligands for Fpr-rs3?

Identifying physiological ligands for Fpr-rs3 presents several methodological challenges that researchers must address:

  • Ligand screening approaches:

    • Development of high-throughput fluorescence-based assays for recombinant Fpr-rs3

    • Calcium imaging in acute VNO preparations from Fpr-rs3-i-Venus mice

    • Electrophysiological recordings during application of candidate ligands

  • Candidate ligand selection:

    • Based on structural similarity to known formyl peptide receptor ligands

    • Screening of pathogen-derived peptides and host damage-associated molecular patterns

    • Investigation of species-specific social communication molecules

  • Technical limitations:

    • Difficulty maintaining membrane protein stability in reconstitution systems

    • Challenges in delivering hydrophobic ligands at physiologically relevant concentrations

    • Need for appropriate control receptors to distinguish specific from non-specific responses

  • Validation requirements:

    • Demonstration of dose-dependent activation

    • Competitive binding assays to confirm direct receptor-ligand interaction

    • In vivo relevance through behavioral assays in Fpr-rs3 knockout models

These methodological challenges highlight the need for multidisciplinary approaches combining molecular, cellular, and behavioral techniques to definitively identify the physiological ligands and functional significance of Fpr-rs3 in the mouse vomeronasal system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.