Recombinant Mouse Formyl peptide receptor-related sequence 6 (Fpr-rs6)

Shipped with Ice Packs
In Stock

Description

Immune Regulation

  • Detects pathogen-associated molecular patterns (PAMPs) like formylated peptides, aiding bacterial clearance .

  • Modulates corticotrophin (ACTH) secretion in the pituitary gland, linking innate immunity to neuroendocrine functions .

  • Interacts with heme-binding protein 1 (Hebp1) to manage oxidative stress responses .

Chemosensory Functions

  • Expressed in mouse vomeronasal organ (VNO) neurons at levels comparable to V1R/V2R chemoreceptors (3.7 neurons per 14 μm section) .

  • Does not co-express with V1R/V2R receptors, suggesting independent chemosensory pathways .

Research Tools

  • ELISA Kits: Quantify Fpr-rs6 in tissue homogenates (0.156–10 ng/ml detection range) .

  • Interaction Studies: STRING database links Fpr-rs6 to Hebp1 (confidence score: 0.738) .

Key Research Findings

  • Inflammation Resolution: Fpr-rs6 activation inhibits NF-κB signaling, reducing IL-1β, IL-6, and TNF-α in chorioamnionitis models .

  • Glucocorticoid Modulation: Co-expressed with Fpr-rs1/rs2 in the anterior pituitary, mediating annexin A1-dependent anti-inflammatory effects .

  • Pathogen Sensing: Detects formylated peptides from Listeria monocytogenes and mitochondria-derived motifs .

Technical Considerations

  • Storage: Short-term at +4°C; long-term at -20°C to -80°C in PBS buffer .

  • Customization: Available for expression systems, tag placement, and sequence optimization .

  • Limitations: Requires 5–9 weeks for custom production; not validated for human diagnostics .

Unresolved Questions

  • Ligand Specificity: Exact endogenous ligands beyond formylated peptides remain undefined.

  • Species-Specificity: Functional divergence from human FPR2 requires further exploration .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
Fpr-rs6; Formyl peptide receptor-related sequence 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fpr-rs6
Target Protein Sequence
MEANFSIPQNGSEVVFYDSTTSRVICIFLVVVLSITFLLGVIGNGLVIYVAGFRMTHTVT TICYLNLALSDFSYMASLPFQITSIVMNGEWLFGWFLCKFVHMIINVNLFLSIFLITFIA MDRCICVLHPVWAQNHRTVNVATKVIFGAWILVLMLIFPHCIFVTTVKDESGKVHCICNF ESWAATPEEQVKVSMTVSLISVTISFIIGFSIPMIFIVICYGLMAAKIGRRGFVNSSRPL RVLTAVAISFFVCWFPFQLIFLLGNIGNKETQNNIDTWVNTASTLASFNSCLNPILYVFL GQQFRERLIYSLSASLERALREDSALNSDKTRNLSSQRL
Uniprot No.

Target Background

Function
May possess an olfactory function involved in the detection of pathogens or pathogenic conditions.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed exclusively in vomeronasal tissue. Expressed in 1.2 % of a subset of sensory neurons located in the apical layer of the vomeronasal organ. Each neuron appears to express only one receptor gene. Expressed in brain, spleen, skeletal muscle and at

Q&A

Technical Methodology

  • What are the optimal conditions for expressing and purifying functional Fpr-rs6 from different host systems?

    Optimal conditions for expressing and purifying functional Fpr-rs6 vary significantly across expression systems:

    Expression SystemOptimal ConditionsPurification StrategySpecial Considerations
    Cell-Free ExpressionTemperature: 25-30°C
    Reaction time: 4-6 hours
    Reducing environment
    Affinity chromatography with His- or GST-tagRequires optimization of redox conditions for proper folding
    E. coliInduction: 0.1-0.5 mM IPTG
    Temperature: 16-20°C
    Duration: 16-20 hours
    Inclusion body solubilization followed by refolding; affinity purificationOften produces inclusion bodies; may require fusion partners
    YeastInduction: 0.5-2% methanol (P. pastoris)
    Temperature: 25-28°C
    Duration: 48-72 hours
    Affinity chromatography followed by size exclusionMonitor glycosylation patterns for consistency
    BaculovirusMOI: 1-5
    Temperature: 27°C
    Harvest: 48-72 hours post-infection
    Membrane extraction with detergents followed by affinity purificationRequires careful selection of detergents to maintain functionality
    Mammalian CellTransient or stable expression
    Temperature: 37°C
    5% CO₂
    Harvest: 48-72 hours
    Gentle membrane solubilization followed by affinity and ion exchange chromatographyMost physiologically relevant but lowest yields

    Key purification considerations for maintaining Fpr-rs6 functionality include:

    1. Detergent selection for membrane protein extraction (e.g., DDM, LMNG, or CHS-containing mixtures)

    2. Buffer composition (typically pH 7.4 with physiological salt concentration)

    3. Addition of stabilizing agents during purification (glycerol, specific lipids)

    4. Temperature control throughout the purification process (4°C recommended)

    Regardless of the expression system used, the target purity should be ≥85% as assessed by SDS-PAGE for most research applications .

  • What experimental design considerations are essential when comparing Fpr-rs6 with other formyl peptide receptors?

    When designing experiments to compare Fpr-rs6 with other formyl peptide receptors, researchers should address several critical considerations:

    1. Expression Standardization: Ensure comparable expression levels across different receptor subtypes through:

      • Quantitative flow cytometry for cell surface expression

      • Western blotting with epitope tags for total expression

      • Binding site titration with saturating ligand concentrations

    2. Experimental Controls:

      • Include positive control ligands known to activate specific receptor subtypes

      • Use receptor-null cells as negative controls

      • Include cross-desensitization experiments to distinguish receptor-specific effects

    3. Ligand Selection:

      • Test a diverse panel of formylated and non-formylated peptides

      • Include receptor-selective agonists and antagonists when available

      • Use concentration-response curves rather than single concentrations

    4. Data Analysis Approaches:

      • Apply appropriate statistical methods for comparing potency (EC₅₀/IC₅₀) and efficacy

      • Use multivariate analysis to identify patterns in receptor response profiles

      • Consider bias factor calculations for comparing signaling pathway activation

    5. Experimental Design Structure:

      • Implement factorial design to systematically vary ligands and receptors

      • Use randomized block designs to control for experimental variation

      • Ensure adequate replication based on power analysis2

    Example design matrix for systematic receptor comparison:

    ReceptorLigand 1Ligand 2Ligand 3...Ligand n
    Fpr-rs6EC₅₀, EmaxEC₅₀, EmaxEC₅₀, Emax...EC₅₀, Emax
    Fpr1EC₅₀, EmaxEC₅₀, EmaxEC₅₀, Emax...EC₅₀, Emax
    Fpr2EC₅₀, EmaxEC₅₀, EmaxEC₅₀, Emax...EC₅₀, Emax
    Fpr-rs1EC₅₀, EmaxEC₅₀, EmaxEC₅₀, Emax...EC₅₀, Emax

    This systematic approach enables meaningful comparison of pharmacological profiles across receptor subtypes while minimizing experimental biases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.