Recombinant Mouse Formyl peptide receptor-related sequence 7 (Fpr-rs7)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

Fpr-rs7 belongs to the formyl peptide receptor (FPR) family, a cluster of G-protein coupled receptors (GPCRs) involved in immune regulation and sensory functions.

FeatureDetailsSource
Gene NameFpr-rs7
UniProt IDQ71MR7
Chromosomal LocationMouse chromosome 17A3.2
Family MembersFpr1, Fpr-rs1, Fpr-rs2, Fpr-rs3, Fpr-rs4, Fpr-rs6, Fpr-rs7

Gene Cluster Complexity

Mouse FPR receptors exhibit greater diversity than human counterparts, complicating functional extrapolation . For example:

  • Fpr1: Binds N-formylated peptides (e.g., fMLF), mediating neutrophil chemotaxis .

  • Fpr-rs1/2: Bind anti-inflammatory lipoxins (e.g., LxA4) and resolvins .

  • Fpr-rs7: No confirmed ligands; potential roles include olfactory sensing or pathogen detection, as suggested by its homology to sensory receptors .

Experimental Applications

Fpr-rs7 is primarily used in:

ApplicationMethodSource
SDS-PAGEPurity validation
Western BlottingTag detection (His-tag)
Functional StudiesLigand-binding assays (hypothetical, based on family homology)

Comparative Analysis of Mouse FPR Receptors

ReceptorLigandsProposed FunctionSource
Fpr1N-formyl peptides (e.g., fMLF)Bacterial chemotaxis, inflammation
Fpr-rs1/2Lipoxins (LxA4), resolvinsAnti-inflammatory signaling
Fpr-rs3/4/6/7UnknownUncharacterized roles (sensory, immune?)

Fpr-rs7’s sequence aligns most closely with Fpr-rs6 and Fpr-rs4, suggesting potential redundancy or specialized functions within the cluster .

Challenges and Future Directions

  1. Functional Ambiguity: Unlike Fpr1 or Fpr-rs1, Fpr-rs7 lacks validated ligands or knockout phenotypes.

  2. Expression Variability: Recombinant Fpr-rs7 is produced in E. coli or mammalian cells, which may affect post-translational modifications .

  3. Research Gaps: Limited studies on Fpr-rs7-specific signaling pathways or tissue expression profiles.

Future research should prioritize:

  • Ligand screening using recombinant Fpr-rs7.

  • RNA/protein expression profiling in olfactory or immune tissues.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Fpr-rs7; Formyl peptide receptor-related sequence 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Fpr-rs7
Target Protein Sequence
MEANFSIPQNGSEVVFYDSTTSRVICIFLVVVLSITFLLGVIGNGLVIYVAGFRMTHTVT TICYLNLALSDFSYMTSLPFQITSIVMNGEWLFGWFLCKFVHMIINVNLFLSIFLITFIA MDRCICVLHPVWAQNHRTVNLARKVIFGSWILVLMLIFPHFFFLTTVKDESGKVHCICNF ESWAATPEEQVNMSMTVSLISVTLSFIVGFSIPMIFIVICYGLMAAKIGRRGLVNSSRPL RVLTAVAFSFFVCWFPFQLIFLLGNIGNKETQNNIDAWVNPASTLASFNSCLNPILYVFL GQQFRERLIYSLSASLERALREDSALNSDKIRNLSSQT
Uniprot No.

Target Background

Function
May possess an olfactory function involved in the detection of pathogens or pathogenic states.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed exclusively in vomeronasal organ. Expressed in 0.8 % of a subset of sensory neurons located in the apical layer of the vomeronasal organ. Each neuron appears to express only one receptor gene. Expressed in heart, liver, lung, spleen smooth muscl

Q&A

What is Fpr-rs7 and how does it relate to other formyl peptide receptors?

Fpr-rs7 is a G protein-coupled receptor belonging to the formyl peptide receptor family in mice. Similar to other family members like Fpr2, it likely functions in the transduction of signals from various ligands to regulate inflammatory processes . The murine formyl peptide receptor family comprises multiple members with varying degrees of homology, with Fpr-rs7 sharing structural similarities to the well-studied Fpr2, though with distinct ligand specificity profiles.

Research with Fpr2 knockout models has demonstrated that these receptors play significant anti-inflammatory roles, serving various regulatory functions during host defense responses . By extrapolation, Fpr-rs7 likely contributes to similar physiological processes, though with potential functional specializations that remain to be fully characterized.

What expression pattern does Fpr-rs7 exhibit in murine tissues?

Fpr-rs7 shows a tissue-specific expression pattern that differs from other family members. While comprehensive expression data for Fpr-rs7 specifically is still emerging, research on related receptors like Fpr2 indicates expression primarily in immune cells such as neutrophils and macrophages. Methodologically, researchers can determine Fpr-rs7 expression using:

  • Quantitative RT-PCR with receptor-specific primers

  • In situ hybridization for tissue localization

  • Immunohistochemistry with validated antibodies

  • Flow cytometry for cellular expression

Experimental validation should include appropriate controls, particularly given the sequence similarities among Fpr family members.

What signaling pathways are activated by Fpr-rs7?

Based on studies of homologous receptors, Fpr-rs7 likely activates several intracellular signaling cascades following ligand binding. Studies with Fpr2 have shown that receptor activation leads to ERK phosphorylation induced by ligands such as annexin A1-derived peptide Ac2–26 and other receptor-specific compounds .

Methodological approaches to study Fpr-rs7 signaling should include:

  • Western blotting for phosphorylated signaling proteins (ERK, p38 MAPK)

  • Calcium flux assays to measure intracellular calcium mobilization

  • cAMP accumulation assays to assess G protein coupling

  • β-arrestin recruitment assays for receptor internalization studies

When designing experiments, researchers should consider using specific inhibitors to dissect the contributions of individual pathways to the observed cellular responses.

How does Fpr-rs7 influence neutrophil migration and inflammatory responses?

While specific data for Fpr-rs7 requires further investigation, research on Fpr2 provides valuable insights. Fpr2 demonstrates significant anti-inflammatory properties, with knockout mice showing increased cell adherence and emigration in the mesenteric microcirculation following ischemia-reperfusion injury . Additionally, the antimigratory effects of compounds such as lipoxin A4, annexin A1, and dexamethasone were substantially reduced in Fpr2-deficient mice .

For studying Fpr-rs7's role in neutrophil migration, researchers should consider:

  • Transwell migration assays with isolated neutrophils

  • In vivo neutrophil recruitment models (air pouch, peritonitis)

  • Intravital microscopy to visualize leukocyte-endothelial interactions

  • Flow cytometry analysis of adhesion molecule expression

What are the methodological considerations for generating and validating Fpr-rs7 knockout models?

Creating reliable Fpr-rs7 knockout models requires careful design and comprehensive validation. Based on approaches used for Fpr2 knockout mice, researchers should:

  • Employ gene targeting strategies that ensure complete deletion of functional receptor expression

  • Verify deletion through multiple methods:

    • Southern blot analysis to confirm gene targeting

    • PCR genotyping for routine screening

    • Functional validation through radioligand binding assays

    • Absence of receptor-mediated cellular responses

The development of Fpr2 knockout mice has provided valuable insights into anti-inflammatory functions, revealing that these mice exhibit exacerbated inflammation in various models and inability to resolve chronic pathology . Similar approaches for Fpr-rs7 would likely yield important functional data.

What ligand binding assays are most effective for studying Fpr-rs7 specificity?

To characterize Fpr-rs7 ligand binding with precision:

  • Radioligand binding assays using cells expressing recombinant Fpr-rs7

  • Competition binding assays with potential ligands

  • Scatchard analysis to determine binding affinities

  • BRET/FRET-based binding assays for real-time binding kinetics

Research with Fpr2 has employed radioligand binding assays to confirm the functional absence of the receptor in knockout models . Similar methodologies can be adapted for Fpr-rs7, with appropriate controls to account for potential binding to other formyl peptide receptors.

How can researchers differentiate between Fpr-rs7 and other FPR family member functions?

Distinguishing Fpr-rs7-specific functions from those of related receptors requires strategic experimental design:

  • Use receptor-selective ligands where available

  • Employ siRNA or CRISPR-Cas9 for selective receptor knockdown

  • Utilize cells from knockout mice lacking specific receptor subtypes

  • Perform receptor reconstitution experiments in knockout backgrounds

  • Create chimeric receptors to identify structural determinants of specificity

Studies with Fpr2 knockout mice demonstrated that ERK phosphorylation triggered by serum amyloid A remained intact, while responses to the annexin A1-derived peptide Ac2–26 and other Fpr2-specific ligands were markedly attenuated . Similar strategies can help delineate Fpr-rs7's unique functional profile.

What are the implications of Fpr-rs7 in chronic inflammatory disease models?

While direct evidence for Fpr-rs7 in chronic inflammation models is still emerging, insights from Fpr2 research are instructive. Fpr2 knockout mice exhibited heightened sensitivity to arthrogenic serum and complete inability to resolve this chronic pathology . This suggests anti-inflammatory and pro-resolving functions that may be shared by Fpr-rs7.

To study Fpr-rs7 in chronic inflammation:

  • Employ multiple disease models (arthritis, inflammatory bowel disease, etc.)

  • Assess both acute and chronic phases of inflammation

  • Measure resolution parameters (specialized pro-resolving mediators, clearance of apoptotic cells)

  • Compare phenotypes between wild-type and receptor-deficient mice

What statistical considerations are important when analyzing Fpr-rs7 functional data?

Appropriate statistical analysis is crucial for rigorous interpretation of Fpr-rs7 research:

  • For comparing wild-type and knockout responses, use appropriate statistical tests based on data distribution:

    • t-tests for normally distributed data

    • Mann-Whitney U test for non-parametric comparisons

    • ANOVA with appropriate post-hoc tests for multiple group comparisons

  • For dose-response experiments:

    • Use non-linear regression to calculate EC50/IC50 values

    • Compare curve parameters statistically

  • For time-course experiments:

    • Consider area under curve (AUC) analysis

    • Apply repeated measures ANOVA where appropriate

The following F-table provides critical values for testing significance in ANOVA analyses commonly used in receptor studies:

F-table of Critical Values for Significance Level = 0.05

DF2 \ DF112345
56.615.795.415.195.05
104.964.103.713.483.33
154.543.683.293.062.90
204.353.493.102.872.71
304.173.322.922.692.53

Results are significant when the F-value exceeds the critical value in the table .

How should researchers interpret contradictory findings regarding Fpr-rs7 function?

When confronted with conflicting results:

  • Carefully evaluate experimental conditions:

    • Cell types and sources

    • Ligand concentrations and purity

    • Assay conditions and readouts

    • Mouse strain differences

  • Consider receptor expression levels:

    • Endogenous vs. overexpression systems

    • Compensatory changes in knockout models

  • Examine potential context-dependent functions:

    • Inflammatory state of the system

    • Presence of co-receptors or regulatory proteins

    • Influence of the microenvironment

  • Perform rigorous validation experiments:

    • Independent replication with varied approaches

    • Use of multiple ligands and readouts

    • Genetic and pharmacological approaches

How do findings from murine Fpr-rs7 studies translate to human FPR biology?

Translating mouse Fpr-rs7 research to human applications requires careful consideration of species differences:

  • Conduct comparative sequence and structure analysis between murine Fpr-rs7 and human FPR family members

  • Perform parallel functional studies in mouse and human cells

  • Validate findings in humanized mouse models where appropriate

  • Correlate receptor expression patterns between species

Research on Fpr2 has supported the development of receptor agonists as potential anti-inflammatory therapeutics . Similar translational approaches may be applicable to Fpr-rs7-targeted interventions, pending further characterization of its specific functions.

What therapeutic implications arise from Fpr-rs7 research?

Understanding Fpr-rs7 biology may contribute to novel therapeutic strategies:

  • Development of selective Fpr-rs7 modulators (agonists/antagonists)

  • Identification of endogenous ligands with therapeutic potential

  • Targeting of Fpr-rs7-dependent pathways in inflammatory conditions

  • Biomarker development based on receptor expression or activity

Research with Fpr2 has demonstrated its anti-inflammatory role and importance in resolving chronic inflammation , suggesting that targeting these receptors may offer therapeutic benefits in inflammatory diseases. As Fpr-rs7 functions become better characterized, similar applications may emerge.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.