Recombinant Mouse Free fatty acid receptor 3 (Ffar3)

Shipped with Ice Packs
In Stock

Description

Metabolic Regulation

  • Insulin Secretion: Ffar3 activation inhibits glucose-stimulated insulin secretion (GSIS) via Gαi/o signaling. Ffar3-knockout mouse islets show 40% higher insulin secretion at high glucose concentrations compared to wild-type controls .

  • Energy Homeostasis: Modulates sympathetic nervous system activity by regulating norepinephrine release, impacting heart rate and energy expenditure .

Immune Modulation

  • Inflammation Control: Ffar3 activation in intestinal epithelial cells reduces chemokine/cytokine production, potentially mitigating inflammatory bowel disease .

Neurological Effects

  • Sympathetic Neurons: Electrophysiological studies show Ffar3-expressing neurons exhibit reduced CaV2.2 channel activity upon ligand binding, influencing cardiovascular function .

Experimental Models

ApplicationKey FindingsSource
Diabetes StudiesFFAR3 agonist AR420626 improved glucose tolerance in murine models .
Cardiovascular ResearchFfar3-knockout mice develop arterial stiffness and cardiac fibrosis .
Gut-Brain Axis AnalysisFFAR3 links SCFA production to sympathetic ganglia activity .

Technical Utility

  • Ligand Screening: Used to test selective agonists (e.g., 1-methylcyclopropane carboxylate) and antagonists (e.g., β-hydroxybutyrate) .

  • Transcriptomic Profiling: RNA sequencing of Ffar3-knockout islets revealed 4,165 differentially expressed genes, including Sst (somatostatin) and Ghrl (ghrelin) .

Key Research Findings

  1. Dual Receptor Dynamics:
    FFAR3 forms heteromers with FFAR2 in immune cells, synergistically regulating cAMP levels and inflammatory responses .

  2. Species-Specific Effects:
    Murine FFAR3 shows stronger coupling to CaV2.2 channels than human orthologs, complicating translational studies .

  3. Therapeutic Potential:

    • Obesity: FFAR3 activation increases PYY and GLP-1 secretion, suppressing appetite in mice .

    • Hypertension: Lower FFAR3 levels correlate with arterial stiffness in hemodialysis patients .

Challenges and Future Directions

  • Ligand Specificity: Propionate and butyrate exhibit overlapping binding with FFAR2, requiring selective pharmacological tools .

  • Human vs. Murine Discrepancies: Murine FFAR3 regulates insulin secretion more potently than human FFAR3, necessitating species-specific models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it if possible.
Synonyms
Ffar3; Gm478; Gpr41; Free fatty acid receptor 3; G-protein coupled receptor 41
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGTSFFLGNYWLFFSVYLLVFLVGLPLNVMALVVFVGKLRRRPVAVDLLLLNLTISDLLL LLFLPFRMVEAACGMRWLLPFIFCPLSGFLFFTTIYLTSLFLTAVSIERFLSVAYPLWYK TRPRLAQAGLVSVVCWFLASAHCSVVYITEYWGNATYSQGTNGTCYLEFREDQLAILLPV RLEMAVVLFMVPLCITSYCYSRLVWILSRGASRRRRKRIMGLLAATLLIFFVCFGPYNMS HVVGYVSRESPSWRSYVLLLSTLNSCIDPLVFYFSSSKFQADFHQLLGRLLRTCVPWTQQ VSLELKVKNGEEPSKECPS
Uniprot No.

Target Background

Function
Free fatty acid receptor 3 (FFAR3), also known as G protein-coupled receptor 41 (GPR41), is a G protein-coupled receptor activated by short-chain fatty acids (SCFAs), major products of dietary fiber digestion. It plays a crucial role in regulating whole-body energy homeostasis and intestinal immunity. In omnivorous mammals, SCFAs like acetate, propionate, and butyrate are primarily produced by the gut microbiome through the metabolism of dietary fibers. These SCFAs serve as energy sources and signaling molecules. FFAR3 is likely coupled to the pertussis toxin-sensitive, G(i/o)-alpha family of G proteins. Its activation triggers the production of inositol 1,4,5-trisphosphate, mobilization of intracellular calcium, phosphorylation of MAPK3/ERK1 and MAPK1/ERK2 kinases, and inhibition of intracellular cAMP accumulation. Activated by SCFAs and beta-hydroxybutyrate, a ketone body produced by the liver during starvation, FFAR3 inhibits N-type calcium channels and modulates the activity of sympathetic neurons through a signaling cascade involving G protein subunits (beta and gamma), phospholipase C, and MAP kinases. This modulation contributes to energy expenditure regulation by influencing the sympathetic nervous system, which controls factors like heart rate. When activated by SCFAs accumulating in the intestine, FFAR3 may also signal to the brain via neural circuits, regulating intestinal gluconeogenesis. Additionally, FFAR3 may control the production of hormones involved in whole-body energy homeostasis. For instance, it might regulate blood pressure through renin secretion. It may also regulate the secretion of the PYY peptide by enteroendocrine cells and control gut motility, intestinal transit rate, and energy harvesting from SCFAs produced by gut microbiota. Furthermore, FFAR3 may indirectly regulate the production of LEP/Leptin, a hormone that inhibits food intake in the central nervous system, in response to the presence of short-chain fatty acids in the intestine. Finally, it may contribute to glucose homeostasis. Beyond its role in energy homeostasis, FFAR3 participates in intestinal immunity. It may mediate the activation of the inflammatory and immune response by SCFAs in the gut, regulating the rapid production of chemokines and cytokines by intestinal epithelial cells. FFAR3 exhibits a constitutive G protein-coupled receptor activity independent of SCFAs.
Gene References Into Functions
  1. Gpr41 KO mice exhibit hypertension of vascular origin. PMID: 27664183
  2. The maternal microbiome influences Treg differentiation in the thymus of offspring through GPR41-mediated Aire expression. PMID: 29021375
  3. GPR41 and its ligands, short-chain fatty acids, may play a significant role in fine-tuning insulin secretion during both fed and fasting states. PMID: 27550964
  4. Pharmacological and knockdown experiments demonstrate that activation of sympathetic neurons by SCFA propionate involves SCFA receptor GPR41, linking to Gbetagamma-PLCbeta3-ERK1/2-synapsin 2. PMID: 22673524
  5. GPR41 mediates beta cell glucose-stimulated insulin secretion through a Galphai/o-sensitive pathway. PMID: 26091414
  6. Results indicate that FFAR3 is expressed on postganglionic sympathetic and sensory neurons in both the autonomic and somatic peripheral nervous system. PMID: 25637492
  7. FFAR3 is expressed in pancreatic beta cells and mediates an inhibition of insulin secretion by coupling to Gi-type G proteins. PMID: 25581519
  8. Data from transgenic mice suggest that Ffar3/Gpr41 and Ffar2/Gpr43 both act as sensors for short-chain fatty acids in enteroendocrine cells; Ffar3/Gpr41 appears to play this role exclusively in enteric neurons, and Ffar2/Gpr43 exclusively in enteric leukocytes. PMID: 23885020
  9. Short-chain fatty acids activate GPR41 on intestinal epithelial cells, leading to mitogen-activated protein kinase signaling and rapid production of chemokines and cytokines. These pathways mediate protective immunity and tissue inflammation in mice. PMID: 23665276
  10. GPR41 gene expression is mediated by internal ribosome entry site (IRES)-dependent translation of bicistronic mRNA encoding GPR40 and GPR41 proteins. PMID: 22493486
  11. Short chain fatty acids and ketone bodies directly regulate GPR41-mediated sympathetic nervous system activity and thereby control body energy expenditure in maintaining metabolic homeostasis. PMID: 21518883
  12. Gpr41 is a regulator of host energy balance through effects dependent on the gut microbiota. PMID: 18931303
  13. This review discusses the mechanism of receptor activation, pharmacology, and physiological functions of fatty acid binding receptors GPR40, GPR41, GPR43, and GPR119. PMID: 19009545

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in white adipose tissue and skeletal muscle (at protein level). Abundantly expressed in sympathetic ganglia such as the superior cervical ganglion. Also expressed by intestinal endocrine cells.

Q&A

What is Ffar3 and what are its primary functions in mouse physiology?

Ffar3 (also known as GPR41) is a G protein-coupled receptor that responds primarily to short-chain fatty acids (SCFAs). In mice, Ffar3 has several key physiological roles including regulation of glucose metabolism, sympathetic nervous system activation, and vascular function. Ffar3 signals exclusively through the Gαi/o pathway, which distinguishes it from the related receptor Ffar2 that can signal through both Gαi/o and Gαq/11 pathways . This signaling mechanism is particularly important in pancreatic β cells where Ffar3 activation inhibits glucose-stimulated insulin secretion . Additionally, Ffar3 has been identified in sympathetic neurons, particularly those with a vasoconstrictor phenotype, suggesting its role in sympathetic outflow and vascular tone regulation .

How does Ffar3 signaling differ from other fatty acid receptors in mouse models?

Ffar3 has distinctive signaling properties compared to other fatty acid receptors. Unlike Ffar2, which can signal through multiple G protein pathways (Gαq/11 and Gαi/o), Ffar3 signals exclusively through the Gαi/o pathway . This is significant because the Gαi/o pathway typically inhibits adenylyl cyclase, reducing cAMP levels and subsequently affecting downstream signaling cascades. In pancreatic islets, this inhibitory signaling mechanism directly impacts glucose-stimulated insulin secretion . Propionate has been identified as highly selective for Ffar3 compared to Ffar2, making it a useful tool for distinguishing between these receptors in experimental settings . Additionally, while some fatty acid receptors have broad ligand specificity, Ffar3 is primarily activated by short-chain fatty acids, particularly those produced by gut microbiota, positioning it as a critical mediator in the gut-systemic signaling axis.

What are the primary tissue expression patterns of Ffar3 in mice?

Ffar3 exhibits a specific tissue distribution pattern in mice. Research has demonstrated Ffar3 expression in pancreatic islets, particularly β cells where it regulates insulin secretion . Ffar3 is also expressed in various peripheral arteries as shown by quantitative PCR analysis . Additionally, Ffar3 shows significant expression in sympathetic neurons, particularly those with a vasoconstrictor phenotype . RNA sequencing data from islet studies has revealed that Ffar3 knockout affects the expression of numerous genes related to metabolic processes, transcription regulation, and pathways implicated in type 2 diabetes . The receptor's expression in these diverse tissues suggests its involvement in coordinating metabolic responses across multiple organ systems, potentially serving as an integrator of signals between gut microbiota-derived metabolites and systemic physiological responses.

What mouse models are available for studying Ffar3 function, and what are their key characteristics?

Several mouse models have been developed for studying Ffar3 function. The primary model is the global Ffar3 knockout mouse (Ffar3-/-), which shows complete ablation of Ffar3 gene expression and has been instrumental in determining the receptor's physiological roles . These knockout mice exhibit altered glucose-stimulated insulin secretion, with Ffar3-/- islets secreting significantly more insulin in response to glucose compared to wildtype islets . This phenotype occurs without changes in insulin content, suggesting direct effects on secretory mechanisms rather than insulin production .

Another valuable model is the Ffar3 reporter mouse, which allows for selective tracking of FFAR3-expressing neurons through fluorescent labeling . This model has proven particularly useful for electrophysiological studies of identified FFAR3-expressing neurons, revealing that these neurons comprise a specific subpopulation primarily associated with vasoconstrictor function .

For researchers interested in tissue-specific functions, conditional knockout models may also be available, though these were not specifically mentioned in the search results. When designing experiments with these models, researchers should consider possible compensatory mechanisms that might develop, particularly involving related receptors like Ffar2.

What are the most reliable methods for detecting and quantifying Ffar3 expression in mouse tissues?

Several reliable methods have been validated for detecting and quantifying Ffar3 expression in mouse tissues:

  • Quantitative Real-Time PCR (qRT-PCR): This technique allows for sensitive quantification of Ffar3 mRNA expression. For optimal results, gene-specific primers for Ffar3 should be used alongside appropriate housekeeping genes such as β-actin and GAPDH . Expression should be normalized to the geometric mean of multiple housekeeping genes to enhance reliability .

  • RNA Sequencing: This provides comprehensive gene expression profiles and has been successfully used to analyze differences between wildtype and Ffar3-/- islets, revealing thousands of differentially expressed genes .

  • Immunodetection Methods: Both Western blotting and immunofluorescence can be used to detect Ffar3 protein expression. Specific antibodies against mouse Ffar3 are commercially available for these applications . For immunofluorescence studies, particularly in neuronal tissues, Ffar3 reporter mice provide an excellent tool for identifying Ffar3-expressing cells .

  • Flow Cytometry: For cellular studies, flow cytometry using specific anti-Ffar3 antibodies can quantify receptor expression at the single-cell level .

Each method has specific advantages depending on the research question. For quantitative expression analysis across tissues, qRT-PCR is often preferred, while immunofluorescence provides important spatial information about receptor localization within tissues.

How can researchers effectively validate the specificity of anti-Ffar3 antibodies for mouse studies?

Validating the specificity of anti-Ffar3 antibodies is crucial for obtaining reliable results in mouse studies. A comprehensive validation approach should include:

  • Positive and Negative Controls: Use tissues or cells from Ffar3-/- mice as negative controls to confirm antibody specificity . This is the gold standard for validation as it demonstrates the absence of signal when the target protein is not present.

  • Multiple Detection Methods: Confirm specificity using different techniques such as Western blot, immunofluorescence, and flow cytometry . Each method provides complementary information about antibody performance.

  • Peptide Competition Assays: Pre-incubate the antibody with the immunizing peptide to demonstrate that this blocks specific binding in subsequent applications.

  • Cross-Reactivity Testing: Test the antibody against related receptors (e.g., Ffar2) to ensure it doesn't cross-react with structurally similar proteins.

  • Correlation with mRNA Expression: Compare protein detection patterns with mRNA expression data from qRT-PCR or RNA sequencing to verify consistency between transcript and protein levels .

When selecting commercial antibodies, researchers should review validation data provided by manufacturers and consider using recombinant monoclonal antibodies like those described in search result , as these typically offer higher consistency and specificity compared to polyclonal antibodies.

What electrophysiological approaches are most effective for studying Ffar3-mediated signaling in neuronal cells?

For studying Ffar3-mediated signaling in neuronal cells, whole-cell patch-clamp recordings have proven particularly effective . This approach allows for precise measurement of ionic currents modulated by Ffar3 activation. When implementing this methodology:

  • Cell Identification Strategy: Using Ffar3 reporter mice significantly enhances the efficiency and precision of electrophysiological studies. This approach allows for selective tracking of FFAR3-expressing neurons, which is particularly valuable given the heterogeneity of Ffar3 expression in sympathetic neurons . Research has shown that recordings from identified FFAR3-expressing neurons from reporter mice revealed a 2.5-fold decrease in the Ca(V)2.2-FFAR3 inhibitory coupling variability and 1.5-fold increase in the mean I(Ca2+) inhibition, compared with unlabeled neurons from wild-type mice .

  • Signaling Pathway Analysis: Focus on measuring N-type calcium (Ca(V)2.2) channel currents, as these are key targets of Ffar3-mediated inhibition in sympathetic neurons . Experimental designs should include specific agonists (e.g., propionate or synthetic agonists like 1-methylcyclopropane carboxylate) and antagonists to confirm Ffar3-specific effects.

  • Controls: Always include recordings from Ffar3-/- neurons to confirm the specificity of observed responses and eliminate potential off-target effects of agonists or antagonists .

This approach provides critical insights into the functional consequences of Ffar3 activation in specific neuronal subpopulations and helps elucidate the receptor's role in sympathetic nervous system regulation.

What are the optimal conditions for studying Ffar3-mediated effects on insulin secretion in isolated mouse islets?

Studying Ffar3-mediated effects on insulin secretion requires careful attention to experimental conditions. Based on successful protocols from the literature:

  • Islet Isolation and Culture: Isolate islets from 10-14 week old mice (both wildtype and Ffar3-/- for comparison) using standard collagenase digestion techniques . Culture islets for 24-48 hours in RPMI medium supplemented with 10% FBS, 11 mM glucose, and antibiotics to allow recovery from isolation stress.

  • Glucose-Stimulated Insulin Secretion (GSIS) Protocol:

    • Pre-incubate islets in low glucose (2.8 mM) Krebs-Ringer buffer for 30-60 minutes

    • Incubate groups of size-matched islets in different glucose concentrations (2.8-16.7 mM) for 60 minutes

    • Test Ffar3 agonists (propionate or 1-methylcyclopropane carboxylate) at concentrations of 100-500 μM

    • Include appropriate vehicle controls and positive controls (e.g., exendin-4 at 10 nM)

  • Insulin Measurement: Quantify secreted insulin using validated ELISA methods and normalize to islet insulin content measured after acid-ethanol extraction .

  • Key Experimental Groups:

    • Basal vs. stimulatory glucose concentrations

    • With/without Ffar3 agonists (propionate, MCPC)

    • With/without Ffar3 antagonists (β-hydroxybutyrate)

    • Combined treatments with other secretagogues (e.g., exendin-4)

This comprehensive approach allows for detailed characterization of how Ffar3 regulates insulin secretion under various physiological conditions.

How can researchers effectively analyze the transcriptional changes associated with Ffar3 activation or deletion?

To effectively analyze transcriptional changes associated with Ffar3 activation or deletion, researchers should implement the following comprehensive approach:

  • RNA Sequencing Methodology: For global transcriptome analysis, RNA-seq offers the most comprehensive assessment. The protocol should include:

    • High-quality RNA extraction from target tissues (RNeasy kit or similar)

    • Library preparation with appropriate depth (30-50 million reads per sample)

    • Paired-end sequencing for improved mapping

    • Multiple biological replicates (minimum n=3-4 per group)

  • Experimental Design Considerations:

    • Compare wildtype vs. Ffar3-/- tissues under basal conditions

    • Include acute and chronic Ffar3 agonist treatment groups

    • Consider tissue-specific responses by analyzing multiple relevant tissues

  • Bioinformatic Analysis Pipeline:

    • Quality control and filtering of raw reads

    • Alignment to reference genome and quantification of gene expression

    • Differential expression analysis (e.g., using DESeq2 or EdgeR)

    • Pathway enrichment analysis using Gene Ontology (GO) and KEGG databases

    • Network analysis to identify key regulatory nodes

  • Validation Strategies:

    • Confirm key findings with qRT-PCR on independent samples

    • Validate protein-level changes for selected targets

    • Functional assays to confirm biological relevance of identified pathways

Previous research using this approach identified 4,165 differentially expressed genes (1,626 downregulated and 2,539 upregulated) in Ffar3-/- islets compared to wildtype . GO analysis revealed effects on metabolic processes, transcription regulation, and pathways implicated in type 2 diabetes . The table below shows some of the most significantly affected genes:

UpregulatedFold ChangeDownregulatedFold Change
Sh2d1aInf2200002J24Rik-3.38
Cd3eInfEgr4-3.18
Folr4InfNr4a1-2.69
Cd3dInfFosb-2.54
Cd19InfGpr6-2.46
Stat44.93Dpf3-1.68
Il2rb4.92Cbx8-1.67
Tcf74.79Nap1l5-1.67
Lfng4.72Cx3cr1-1.67
Csf2rb4.58Gem-1.65

This approach provides comprehensive insights into the transcriptional networks regulated by Ffar3, enabling identification of novel mechanistic pathways.

How can researchers reconcile contradictory findings regarding Ffar3's role in metabolic regulation?

Reconciling contradictory findings in Ffar3 research requires systematic analysis of methodological differences and contextual factors:

To systematically reconcile contradictions, create a comprehensive comparison table mapping key variables across studies, identify patterns in discrepancies, and design experiments specifically addressing the most likely sources of variation.

What are the key considerations when interpreting Ffar3 knockout phenotypes versus pharmacological manipulation?

When interpreting Ffar3 research, distinguishing between genetic knockout and pharmacological manipulation outcomes requires careful consideration of several factors:

  • Developmental Compensation in Knockout Models:

    • Global Ffar3-/- mice may develop compensatory mechanisms during development that mask the acute effects of Ffar3 absence

    • RNA sequencing data has revealed thousands of differentially expressed genes in Ffar3-/- islets compared to wildtype, indicating widespread transcriptional adaptation

    • Consider using inducible knockout systems to minimize developmental compensation

  • Specificity of Pharmacological Tools:

    • Evaluate ligand selectivity between Ffar3 and related receptors (especially Ffar2)

    • Propionate has been identified as highly selective for Ffar3 compared to Ffar2

    • The synthetic agonist 1-methylcyclopropane carboxylate (MCPC) decreased glucose-stimulated insulin secretion in wildtype but not Ffar3-/- islets, confirming its specificity

    • β-hydroxybutyrate acts as an endogenous Ffar3 antagonist but may have off-target effects

  • Dose-Response Relationships:

    • Pharmacological studies should include full dose-response curves

    • Different concentrations of ligands may activate different signaling pathways

    • In vivo concentrations of endogenous ligands may differ from those used experimentally

  • Temporal Considerations:

    • Acute versus chronic receptor activation may yield different outcomes

    • Receptor desensitization or internalization may occur with prolonged agonist exposure

  • Integrated Interpretation Approach:

    • Cross-validate findings between knockout and pharmacological studies

    • Use knockout models to confirm on-target effects of pharmacological agents

    • Complement both approaches with molecular and cellular readouts of receptor activation

How do you analyze the tissue-specific roles of Ffar3 when expression patterns differ between mouse and human tissues?

Analyzing tissue-specific roles of Ffar3 across species requires a systematic approach to address translational challenges:

  • Comprehensive Comparative Expression Mapping:

    • Generate detailed expression maps of Ffar3 across tissues in both species using RNA-seq, qPCR, and protein detection methods

    • Quantify relative expression levels in corresponding tissues

    • Create a comparative expression table highlighting similarities and differences

  • Functional Conservation Analysis:

    • For tissues with conserved expression, determine if signaling mechanisms are also conserved

    • Test whether mouse and human Ffar3 respond similarly to the same agonists

    • Compare downstream signaling pathways and physiological outcomes

  • Cross-Species Validation Strategies:

    • Validate key mouse findings in human cell lines or primary cells

    • Use humanized mouse models expressing human Ffar3 in specific tissues

    • Compare pharmacological responses between species-specific cell systems

  • Interpretation Framework for Discrepancies:

    • When expression patterns differ, consider evolutionary adaptations related to diet or metabolism

    • Evaluate if other receptors might serve complementary functions in tissues where Ffar3 expression differs

    • Assess if the observed differences correlate with species-specific physiological characteristics

  • Translational Implications Documentation:

    • Clearly document which findings are likely to translate between species

    • Identify potential compensatory mechanisms that might mask phenotypes in either species

    • Develop practical guidelines for extrapolating mouse Ffar3 research to human applications

This systematic approach helps researchers navigate the complex landscape of species differences while maximizing the translational value of mouse Ffar3 studies. For example, while human studies have shown FFAR3 expression in vascular cells, mouse studies have demonstrated Ffar3 expression in multiple peripheral arteries and revealed its role in vascular function , suggesting conserved vascular functions despite potential differences in expression patterns.

How can researchers effectively target Ffar3 for studies on glucose metabolism and insulin regulation?

To effectively target Ffar3 for glucose metabolism and insulin regulation studies, researchers should implement a multifaceted approach:

  • Experimental Models Selection:

    • For in vivo studies, utilize both global Ffar3-/- mice and tissue-specific knockout models (β-cell specific or neuron-specific) to distinguish direct versus indirect effects

    • For ex vivo studies, isolated islets provide an excellent system for studying direct effects on insulin secretion

    • For in vitro studies, consider insulin-secreting cell lines with confirmed Ffar3 expression

  • Pharmacological Toolkit Implementation:

    • Use propionate as a selective endogenous Ffar3 agonist (100-1000 μM range)

    • Employ 1-methylcyclopropane carboxylate (MCPC) as a synthetic Ffar3-specific agonist

    • Include β-hydroxybutyrate as an endogenous Ffar3 antagonist

    • Always confirm specificity using Ffar3-/- tissues as negative controls

  • Methodological Approach for Insulin Secretion Studies:

    • Perform glucose-stimulated insulin secretion (GSIS) assays across multiple glucose concentrations (2.8-16.7 mM)

    • Include co-stimulation with established secretagogues (e.g., exendin-4) to assess interactions with other pathways

    • Measure both insulin secretion and islet insulin content to distinguish effects on secretion versus biosynthesis

  • Mechanistic Investigation Strategies:

    • Measure cAMP levels to confirm Gαi/o-mediated signaling

    • Assess calcium dynamics in β-cells using fluorescent indicators

    • Investigate KATP channel activity and membrane potential changes

    • Perform RNA-seq to identify transcriptional mechanisms in Ffar3-/- versus wildtype islets

This comprehensive approach has revealed that genetic ablation of Ffar3 increases insulin secretory capacity in response to increasing glucose levels without affecting insulin content . Furthermore, pharmacological activation of Ffar3 with propionate or MCPC significantly decreases glucose-stimulated insulin secretion in wildtype but not Ffar3-/- islets, confirming the inhibitory role of this receptor in insulin secretion .

What are the most promising approaches for studying Ffar3's role in the gut-brain axis and neuronal signaling?

Studying Ffar3's role in the gut-brain axis and neuronal signaling requires specialized approaches that capture the complexity of neural circuits and signal transduction:

  • Neural Circuit Mapping Techniques:

    • Use Ffar3 reporter mice to visualize the distribution of Ffar3-expressing neurons across the nervous system

    • Implement retrograde tracing combined with Ffar3 immunostaining to identify projection patterns

    • Apply optogenetic or chemogenetic tools in Ffar3-expressing neurons to manipulate specific neural populations

  • Electrophysiological Approaches:

    • Perform whole-cell patch-clamp recordings from identified Ffar3-expressing neurons to measure direct effects on neuronal excitability

    • Focus on measuring N-type calcium (CaV2.2) currents, as these are key targets of Ffar3-mediated inhibition in sympathetic neurons

    • Compare recordings from identified FFAR3-expressing neurons from reporter mice versus unlabeled neurons to reduce variability and increase sensitivity

  • Functional Assessment of Sympathetic Output:

    • Measure catecholamine release in response to Ffar3 agonists

    • Record sympathetic nerve activity in vivo while manipulating Ffar3 signaling

    • Assess cardiovascular parameters (blood pressure, heart rate) as downstream readouts of sympathetic tone

  • Gut-Brain Communication Studies:

    • Use microbiota manipulation (germ-free, antibiotic treatment, or specific bacterial colonization) to alter SCFA production

    • Implement portal vein catheterization to deliver SCFAs directly to the liver, bypassing peripheral circulation

    • Perform vagotomy or sympathectomy to dissect neural versus humoral mechanisms

Research has demonstrated that FFAR3 is expressed primarily in neurons with a vasoconstrictor phenotype, suggesting its role in regulating vascular tone through sympathetic outflow . Additionally, electrophysiological studies have shown that activation of Ffar3 in sympathetic neurons leads to inhibition of N-type calcium channels, providing a mechanistic basis for understanding how this receptor modulates neuronal activity and downstream physiological responses .

How can researchers integrate Ffar3 signaling with broader metabolic and inflammatory pathway studies?

Integrating Ffar3 signaling with broader metabolic and inflammatory pathways requires a multisystem approach that connects microbial metabolism, receptor signaling, and physiological outcomes:

  • Multi-Omics Integration Strategy:

    • Combine transcriptomics (RNA-seq) of multiple tissues from Ffar3-/- and wildtype mice

    • Add metabolomics profiling to identify altered metabolic pathways

    • Include microbiome analysis to correlate SCFA production with Ffar3 activation

    • Perform proteomics and phosphoproteomics to map signaling networks

  • Cross-Pathway Experimental Design:

    • Study interactions between Ffar3 and other metabolic regulators (e.g., insulin signaling, AMPK, mTOR)

    • Investigate Ffar3's role during metabolic challenges (high-fat diet, fasting/refeeding)

    • Examine Ffar3 function in models of inflammation (LPS administration, DSS colitis)

    • Assess cross-talk with other SCFA receptors (Ffar2) and histone deacetylase inhibition pathways

  • Tissue Crosstalk Investigation:

    • Use tissue-specific knockout models to dissect primary versus secondary effects

    • Implement ex vivo tissue culture systems to study direct effects on isolated tissues

    • Develop co-culture systems to examine communication between different cell types

  • Signaling Pathway Analysis Tools:

    • Use phospho-specific antibodies to track activation of key signaling nodes

    • Implement CRISPR screening to identify essential components of Ffar3 signaling

    • Apply pharmacological inhibitors of specific pathways to dissect mechanism

RNA sequencing of Ffar3-/- islets has revealed extensive transcriptional changes affecting 4,165 genes, with Gene Ontology analysis showing enrichment in metabolic processes, transcription regulation, and pathways implicated in type 2 diabetes . This systems-level approach has identified novel connections between Ffar3 signaling and broader metabolic networks, demonstrating how receptor function integrates with global physiological regulation.

The combined analysis of Ffar3's role across tissues, including pancreatic islets, sympathetic neurons, and vascular cells, provides a comprehensive picture of how this receptor serves as an integrative sensor linking microbial metabolism to host physiology through diverse signaling mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.