Recombinant Mouse Frizzled-10 (Fzd10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Fzd10; Fz10; Frizzled-10; Fz-10; CD antigen CD350
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-582
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
ISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCH SHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNK NDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQEHPLKDGGPGRAGCDNPGKFHH VEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPE RPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFG MASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDEL TGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRRVMKTGGENTDKLEKL MVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQHKCKMNNQTKTPDCLMTTSIPA VEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHVCSRGLKRKSRRKPASVVTSAGIYKKA QHPQKPHLGKYELPAQPSACV
Uniprot No.

Target Background

Function
Frizzled-10 (Fzd10) is a receptor for Wnt proteins. It plays a crucial role in the canonical Wnt/beta-catenin signaling pathway. This pathway involves the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. Another signaling pathway involving PKC and calcium fluxes has been observed for some family members, but it is unclear whether it represents a distinct pathway or integrates with the canonical pathway. PKC appears to be essential for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Fzd10 may participate in the transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable).
Gene References Into Functions
  1. The selective expression of FZD10 in brain vascular endothelial cells suggests a potential role of FZD10-Galpha13 signaling in central nervous system angiogenesis. PMID: 28126591
  2. Data demonstrate that Wnt7b signals through Fzd1 and -10 and LRP5, implicating these Wnt coreceptors in the regulation of lung airway and vascular development. PMID: 15923619
  3. Fzd10 interprets Wnt signals during embryonic mesoderm and neural induction. PMID: 17576136
  4. Frizzled10 expression is robust during embryonic development of the CNS and may play a critical role in the spatial and temporal regulation during neural development. PMID: 19056517
  5. Characterization of the Frizzled10-CreER transgenic mouse provides an inducible Cre line for studying Cajal-Retzius cell development. PMID: 19241378
  6. Results suggest that Frizzed 10 mediates Wnt1 signaling to determine sensory neural differentiation in Xenopus in vivo and in mouse cell culture. PMID: 19716814

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Frizzled-10 and what are its structural characteristics?

Frizzled-10 belongs to a family of G protein-coupled receptors that consists of 10 structurally-related proteins. Like other Frizzled family members, Fzd10 features a seven-transmembrane structure with a divergent N-terminal signal peptide and a variable-length C-terminal tail. The protein contains a highly conserved cysteine-rich domain in its extracellular region that is critical for Wnt ligand binding, followed by a variable length linker region. This structural arrangement enables Fzd10 to function as a receptor for Wnt proteins, particularly WNT1 and WNT3A, as demonstrated in developmental studies.

The receptor's structure allows it to form co-receptor complexes with other molecules including LRP, ROR, and Ryk, which influences its signaling capabilities and specificity. The extracellular cysteine-rich domain is particularly important as it creates the binding pocket for Wnt ligands, while the intracellular domains mediate interactions with downstream effectors involved in signal transduction.

What signaling pathways does Frizzled-10 participate in?

Frizzled-10, like other members of the Frizzled family, functions primarily as a receptor in Wnt signaling pathways. Research has demonstrated that Fzd10 can activate both canonical and non-canonical Wnt signaling depending on cellular context and binding partners.

In the canonical pathway, Fzd10 mediates Wnt/β-catenin signaling when appropriate Wnt ligands (particularly WNT1 and WNT3A) bind to the receptor. This has been demonstrated using the 8xSuperTopFlash reporter assay, where Fzd10 was shown to promote WNT1 and WNT3A signaling in the presence of LRP6 co-receptor. This pathway ultimately leads to β-catenin stabilization, nuclear translocation, and regulation of target gene expression.

Fzd10 can also participate in non-canonical Wnt signaling pathways including:

  • Planar Cell Polarity (PCP) pathway, which regulates cell orientation and movement

  • Wnt/Ca²⁺ pathway, which modulates intracellular calcium levels

Interestingly, there appears to be cross-talk between these pathways, as evidenced by observations in colorectal cancer cells where Fzd10 expression showed an inverse correlation with nuclear β-catenin accumulation, contradicting the traditional understanding of canonical Wnt signaling in cancer contexts.

What is the developmental expression pattern of Frizzled-10?

Frizzled-10 exhibits distinct spatiotemporal expression patterns during embryonic development. In mouse models, Fzd10 is predominantly expressed in the dorsal telencephalon during development and becomes confined to the pyramidal cell fields in the adult hippocampus.

Studies using Frizzled10-Cre transgenic mouse lines have revealed the developmental timeline of Fzd10 expression:

  • At embryonic day 10.5 (E10.5), Fzd10 expression is mainly detected in the dorsal telencephalic vesicle and dorsal neural tube

  • By E12.5, Fzd10-expressing cells are widely observed throughout the dorsal telencephalon

  • At E14.5 and E16.5, expression is highly concentrated in the cortex with a distinct border between dorsal and ventral structures

  • In postnatal and adult brains, expression is strong in the cortex, hippocampus, and caudate putamen (CPu)

In chick embryos, Fzd10 is expressed in the dorsal spinal cord, and its expression pattern strongly correlates with that of WNT1 and WNT3A. This co-localization is functionally significant as in situ proximity ligation assays have confirmed direct interaction between Fzd10 and these Wnt proteins.

How does Frizzled-10 contribute to neural development?

Frizzled-10 plays crucial roles in neural development, particularly in the development of the dorsal central nervous system. Research has demonstrated that Fzd10 is required for proliferation in the spinal cord, where it mediates WNT1 and WNT3A signaling to establish a dorsal-to-ventral gradient of β-catenin-dependent Wnt activity.

In the developing telencephalon, Fzd10 expression contributes to the proper formation of cortical and hippocampal structures. The regionally specific expression of Fzd10 in the dorsal telencephalon suggests its involvement in patterning and cell fate determination in these regions.

The Wnt signaling mediated by Fzd10 is critical for multiple aspects of spinal cord development, including:

  • Neural plate closure to form the neural tube

  • Production of the correct types, numbers, and distribution of neuronal cells in the developing neural tube

  • Establishment of dorsal-ventral patterning through gradient formation

  • Regulation of neural progenitor proliferation

These developmental functions highlight why Fzd10 has become an important target for researchers studying neurogenesis and neural patterning mechanisms.

What methodologies are most effective for studying Frizzled-10 protein-protein interactions?

When investigating Frizzled-10 protein interactions, researchers should consider a multi-faceted approach combining several complementary techniques:

  • In situ proximity ligation assay (PLA): This technique has proven effective for detecting direct interactions between Fzd10 and Wnt proteins in tissue samples. PLA offers the advantage of visualizing protein interactions within their native cellular context while providing spatial information about where these interactions occur.

  • Reporter assays: The 8xSuperTopFlash reporter system has been successfully employed to measure Fzd10-mediated Wnt signaling activity. This assay can quantitatively measure canonical Wnt pathway activation when Fzd10 interacts with specific Wnt ligands and co-receptors like LRP6.

  • Co-immunoprecipitation (Co-IP): While not explicitly mentioned in the search results, Co-IP is a standard technique for studying protein-protein interactions that would be valuable for confirming direct binding between Fzd10 and potential interaction partners.

  • FRET/BRET assays: These energy transfer techniques can detect protein-protein interactions in living cells and provide information about the dynamics and kinetics of these interactions.

For more robust analyses, researchers should consider combining these approaches with loss-of-function and gain-of-function studies. Knockdown of Fzd10 using siRNA or CRISPR-Cas9, followed by functional assays, can reveal the physiological relevance of identified interactions. Similarly, overexpression studies using cloned Fzd10 cDNA (such as the Mouse Frizzled-10 VersaClone cDNA) can help establish sufficiency of Fzd10 for particular interactions.

How can the apparent contradiction between Frizzled-10 expression and β-catenin accumulation in colorectal cancer be explained?

The inverse correlation between Frizzled-10 expression and nuclear β-catenin accumulation observed in colorectal cancer represents an intriguing paradox that challenges conventional understanding of Wnt signaling. Two primary hypotheses may explain this seemingly contradictory relationship:

  • Non-canonical pathway activation: Fzd10 may preferentially transduce signals through non-canonical pathways (such as Wnt/Ca²⁺) in colorectal cancer cells. Components of these non-canonical pathways could inhibit nuclear accumulation of β-catenin, creating a negative cross-talk mechanism. Similar negative cross-talk has been observed with mouse Fzd1.

  • Context-dependent signaling: The cellular context, including the presence of specific co-receptors and intracellular signaling components, may determine whether Fzd10 activates canonical or non-canonical pathways. In colorectal cancer, the cellular environment may favor non-canonical signaling through Fzd10.

To investigate this contradiction, researchers should consider:

  • Examining the expression of co-receptors (LRP5/6, ROR, Ryk) in Fzd10-positive versus Fzd10-negative tumor cells

  • Analyzing the activation status of downstream components of both canonical and non-canonical Wnt pathways

  • Performing chromatin immunoprecipitation (ChIP) assays to determine if β-catenin binding to target promoters is affected by Fzd10 expression

  • Using patient-derived organoids to study the functional consequences of Fzd10 expression in a more physiologically relevant context

This contradictory finding highlights the complex nature of Wnt signaling and suggests that the role of Fzd10 in cancer may be more nuanced than initially thought, potentially offering new therapeutic opportunities.

What are the advantages and limitations of using Frizzled10-Cre transgenic mouse models for developmental studies?

The Frizzled10-Cre transgenic mouse model offers several advantages for studying dorsal telencephalic development and conditional gene inactivation, but also has important limitations that researchers should consider.

Advantages:

  • Region-specific Cre expression: The Fzd10 promoter drives Cre expression primarily in the dorsal telencephalon during development and in pyramidal cell fields of the adult hippocampus, allowing for targeted genetic manipulations in these regions.

  • High recombination efficiency: When crossed with ROSA26 reporter mice, the Frizzled10-Cre line demonstrates high Cre recombinase efficiency, ensuring robust and reliable gene deletion or activation.

  • Developmental stage-specific expression: The dynamic expression pattern of Cre in this mouse line allows for the study of gene function at different developmental stages from early embryonic (E10.5) through postnatal development.

  • Circumvention of embryonic lethality: For genes whose conventional knockout causes embryonic lethality, the conditional approach using Frizzled10-Cre allows researchers to study gene function specifically in the dorsal telencephalon without affecting other tissues.

Limitations:

  • Promoter fidelity issues: The Cre expression pattern in the Frizzled10-Cre transgenic line shows differences from the native expression of Frizzled10, likely due to positional effects of transgene insertion, which could lead to unexpected recombination patterns.

  • Potential off-target expression: Cre activity has been detected in regions beyond the telencephalon, including the cerebellum, retina, and spinal cord, which could complicate interpretation of conditional knockout phenotypes.

  • Temporal limitations: While useful for developmental studies, this Cre line may not be suitable for temporal control of gene expression unless combined with inducible systems.

  • Genetic background considerations: The B6/FvB background of these mice may introduce strain-specific effects that could influence experimental outcomes.

For optimal experimental design, researchers should characterize Cre activity patterns in their specific crosses and consider complementary approaches such as in utero electroporation or viral delivery of Cre for more precise spatiotemporal control.

What experimental approaches can be used to determine whether Frizzled-10 signals through canonical or non-canonical Wnt pathways in a specific cellular context?

Determining whether Frizzled-10 signals through canonical or non-canonical Wnt pathways in a specific context requires a multi-faceted experimental approach that examines pathway-specific outcomes. The following methodologies can help researchers make this distinction:

  • Reporter Assays for Canonical Pathway:

    • The 8xSuperTopFlash luciferase reporter assay has been successfully used to measure canonical Wnt/β-catenin signaling mediated by Fzd10

    • This system contains TCF/LEF binding sites upstream of a luciferase gene, allowing quantitative measurement of canonical pathway activation

  • β-catenin Localization and Stability:

    • Immunofluorescence to detect nuclear translocation of β-catenin

    • Western blot analysis of β-catenin phosphorylation status and total levels

    • Analysis of GSK3β phosphorylation state

  • Non-canonical Pathway Markers:

    • Calcium imaging using fluorescent calcium indicators to detect Wnt/Ca²⁺ pathway activation

    • Assays for JNK or ROCK activation to detect PCP pathway signaling

    • Analysis of cytoskeletal rearrangements characteristic of non-canonical Wnt signaling

  • Co-receptor Analysis:

    • Co-expression studies with specific co-receptors like LRP6 (for canonical) or Ror2 (for non-canonical)

    • Co-immunoprecipitation to determine which co-receptors interact with Fzd10 in the specific context

  • Pathway-Specific Inhibitors:

    • Use of inhibitors targeting specific components of canonical (e.g., tankyrase inhibitors) or non-canonical (e.g., CAMKII inhibitors) pathways

    • Analysis of how these inhibitors affect Fzd10-mediated responses

An instructive example from the literature is the discovery of an inverse correlation between Fzd10 expression and nuclear β-catenin accumulation in colorectal cancer cells, which suggested non-canonical signaling despite the conventional association of Wnt signaling with canonical pathways in this cancer type.

For comprehensive analysis, researchers should examine multiple downstream events simultaneously, as Fzd10 might activate different pathways in parallel or sequentially depending on the specific cellular context and available Wnt ligands.

What strategies can be employed to study the functional specificity between different Frizzled receptors in the context of neural development?

Studying the functional specificity between Frizzled receptors, particularly Fzd10, in neural development requires sophisticated experimental strategies that can distinguish the unique roles of highly related receptors. The following approaches are recommended:

  • Spatiotemporal Expression Mapping:

    • Comparative in situ hybridization or immunohistochemistry to map the expression patterns of different Frizzled receptors during neural development

    • Single-cell RNA sequencing to identify cell populations expressing specific combinations of Frizzled receptors

  • Receptor-Specific Genetic Manipulation:

    • Generation and utilization of receptor-specific Cre lines, such as the Frizzled10-Cre line, for conditional gene inactivation or activation

    • CRISPR-Cas9-mediated knockout or knockin approaches targeting specific Frizzled receptors

    • Receptor-specific RNA interference using in utero electroporation

  • Domain Swapping and Mutagenesis:

    • Creation of chimeric receptors containing domains from different Frizzled family members to identify regions responsible for functional specificity

    • Site-directed mutagenesis of key residues in the cysteine-rich domain or intracellular regions that may confer ligand or effector specificity

  • Ligand-Receptor Interaction Analysis:

    • In situ proximity ligation assays to visualize interactions between specific Wnt ligands and Frizzled receptors in developing neural tissue

    • Competition assays to determine binding preferences of different Wnt ligands for specific Frizzled receptors

  • Pathway-Specific Readouts:

    • Utilization of pathway-specific reporter assays in neural progenitors or neurons expressing different Frizzled receptors

    • Analysis of different downstream effects (proliferation, differentiation, migration) in response to specific receptor activation

The Frizzled10-Cre transgenic mouse line provides a valuable tool for these studies, as it enables conditional manipulation of genes in Fzd10-expressing cells in the dorsal telencephalon. This approach has revealed the importance of Fzd10 in cortical and hippocampal development and can be used to study how Fzd10 functions differ from other Frizzled receptors expressed in overlapping or adjacent domains.

What are the optimal conditions for expressing recombinant Frizzled-10 in mammalian cell systems?

Achieving optimal expression of recombinant Frizzled-10 in mammalian cell systems requires careful consideration of several experimental parameters. Based on current research methodologies, the following conditions are recommended:

  • Expression Vector Selection:

    • Vectors containing strong, constitutive promoters (CMV, EF1α) provide high expression levels

    • For more controlled expression, inducible systems like Tet-On/Off may be preferable

    • Inclusion of a Kozak consensus sequence upstream of the start codon enhances translation efficiency

  • Cell Line Considerations:

    • HEK293T cells are commonly used due to their high transfection efficiency and protein production

    • For functional studies, consider cell lines that lack endogenous Frizzled-10 expression but contain other components of Wnt signaling

    • Neural-derived cell lines may provide a more relevant context for studying Fzd10 function in neural development

  • Expression Tags and Modifications:

    • N-terminal tags may interfere with signal peptide processing and should be avoided

    • C-terminal tags (FLAG, HA, His) are preferable for detection and purification

    • Consider including a fluorescent protein tag (GFP, mCherry) for live visualization of expression and trafficking

  • Transfection Parameters:

    • Lipid-based transfection reagents typically yield good results for Frizzled proteins

    • For stable expression, lentiviral or retroviral delivery systems may be more effective

    • Optimal DNA:transfection reagent ratios should be empirically determined for each cell line

  • Post-Transfection Conditions:

    • Expression levels typically peak 24-48 hours post-transfection

    • Lower incubation temperatures (30-32°C) following transfection can improve folding of membrane proteins

    • Addition of chemical chaperones (e.g., DMSO, glycerol) may enhance proper folding and trafficking

For functional studies, co-expression with LRP6 is essential when investigating canonical Wnt signaling, as demonstrated in studies using the 8xSuperTopFlash reporter assay to measure Fzd10-mediated WNT1 and WNT3A signaling.

Commercial resources like the Mouse Frizzled-10 (NP_780493) VersaClone cDNA can provide convenient starting material for expression studies, ensuring full-length, sequence-verified Fzd10 cDNA.

How can researchers effectively analyze the effects of Frizzled-10 on neural progenitor proliferation?

Analyzing the effects of Frizzled-10 on neural progenitor proliferation requires a comprehensive experimental approach that combines molecular, cellular, and in vivo techniques. Based on current research methodologies, the following strategies are recommended:

  • In Vivo Proliferation Analysis:

    • BrdU or EdU pulse-labeling followed by immunohistochemistry to quantify proliferating cells in Fzd10-expressing regions

    • Immunostaining for mitotic markers (phospho-histone H3, Ki67) in wild-type versus Fzd10-manipulated tissues

    • Quantification of cell cycle progression using sequential thymidine analog labeling (IdU/CldU)

  • Ex Vivo and In Vitro Systems:

    • Neurosphere assays to measure self-renewal capacity and proliferation rates of neural progenitors with modified Fzd10 expression

    • Organotypic slice cultures from Frizzled10-Cre mice crossed with conditional reporter or knockout lines

    • Establishment of primary neural progenitor cultures from specific brain regions for controlled manipulation of Fzd10 signaling

  • Genetic Approaches:

    • Conditional knockout using Frizzled10-Cre mice crossed with floxed alleles of interest

    • In utero electroporation of Fzd10 expression constructs or shRNA/CRISPR constructs targeting Fzd10

    • Mosaic analysis to compare wild-type and Fzd10-deficient cells in the same tissue environment

  • Signaling Pathway Analysis:

    • Assessment of canonical Wnt pathway activation using β-catenin nuclear localization or TCF/LEF reporter activity

    • Analysis of cell cycle regulators (cyclins, CDKs) downstream of Fzd10 activation

    • Investigation of cross-talk with other signaling pathways important for neural progenitor proliferation (Notch, Shh)

  • Quantitative Readouts:

    • Cell counting in defined anatomical regions

    • Flow cytometry of dissociated tissue to quantify proliferating populations

    • Time-lapse imaging of labeled progenitors to track division rates and modes

Research has demonstrated that Fzd10 is required for proliferation in the spinal cord, where it mediates WNT1 and WNT3A signaling. Similar approaches can be applied to study its role in other neural progenitor populations, such as those in the developing cortex and hippocampus where Fzd10 expression is also prominent.

What experimental tools can help distinguish between the roles of different Frizzled receptors that may have overlapping expression patterns?

Distinguishing between the roles of different Frizzled receptors with overlapping expression patterns presents a significant challenge in developmental neurobiology research. The following experimental tools and approaches can help researchers address this challenge:

  • Receptor-Specific Genetic Tools:

    • Conditional knockout alleles for individual Frizzled receptors

    • Receptor-specific Cre driver lines, such as the Frizzled10-Cre line, for selective manipulation of gene expression

    • CRISPR-Cas9-mediated generation of receptor-specific reporter knockin lines to visualize expression with cellular resolution

  • Pharmacological Approaches:

    • Development and utilization of receptor-selective agonists or antagonists

    • Structure-based design of peptides that can interfere with specific Frizzled-Wnt interactions

    • Small molecules targeting receptor-specific downstream signaling components

  • Biochemical Discrimination Methods:

    • Receptor-specific antibodies for immunoprecipitation or immunohistochemistry

    • Proximity ligation assays to detect specific receptor-ligand interactions in situ

    • Affinity purification followed by mass spectrometry to identify receptor-specific protein complexes

  • Advanced Imaging Techniques:

    • Multi-color FISH or multiplexed immunofluorescence to simultaneously visualize multiple Frizzled receptors

    • Super-resolution microscopy to determine subcellular localization differences between receptors

    • FRET/BRET assays to monitor specific receptor activation in real-time

  • Temporal Control Systems:

    • Inducible gene expression or deletion systems to manipulate receptor function at specific developmental time points

    • Optogenetic control of receptor activity for precise spatiotemporal manipulation

    • Degrader technologies (e.g., PROTACs) for rapid and selective protein degradation

A combined approach using these tools can help elucidate the specific contributions of Fzd10 versus other Frizzled family members. For example, comparing phenotypes between Frizzled10-Cre-driven conditional knockouts and knockouts of other Frizzled receptors can reveal unique versus redundant functions. Similarly, rescue experiments using receptor chimeras can identify domains responsible for specific functions.

How should researchers design experiments to investigate the potential therapeutic applications of targeting Frizzled-10 in disease models?

Designing experiments to investigate the therapeutic potential of targeting Frizzled-10 requires a systematic approach that spans from basic mechanistic studies to preclinical models. The following experimental design framework is recommended:

  • Target Validation in Disease Contexts:

    • Analysis of Fzd10 expression in relevant disease tissues compared to normal controls

    • Correlation of expression levels with disease progression or clinical outcomes

    • Functional studies using genetic manipulation (overexpression, knockdown, mutation) in disease models

  • Mechanism-of-Action Studies:

    • Determine whether Fzd10 mediates disease effects through canonical or non-canonical Wnt pathways

    • Identify disease-specific binding partners and downstream effectors

    • Investigate cross-talk with other signaling pathways relevant to the disease

  • Therapeutic Agent Development:

    • Generation of neutralizing antibodies against the extracellular domain of Fzd10

    • Design of decoy receptors or peptide mimetics that can compete for Wnt binding

    • Development of small molecules targeting Fzd10-specific binding pockets or interactions

  • In Vitro Efficacy Testing:

    • Cell-based assays measuring pathway activity (reporter assays, phosphorylation status)

    • Functional readouts relevant to disease (proliferation, migration, differentiation)

    • Organoid models derived from patient samples to evaluate efficacy in complex tissues

  • In Vivo Preclinical Models:

    • Genetic models using Frizzled10-Cre mice crossed with disease-relevant strains

    • Xenograft or allograft models for cancer applications

    • Pharmacokinetic and pharmacodynamic studies of Fzd10-targeting agents

  • Biomarker Development:

    • Identification of downstream signatures that predict response to Fzd10 targeting

    • Development of companion diagnostics to identify patients likely to benefit

    • Non-invasive monitoring approaches to track therapeutic efficacy

The inverse correlation between Fzd10 expression and nuclear β-catenin accumulation observed in colorectal cancer presents an intriguing therapeutic opportunity. Understanding this relationship could lead to novel strategies for targeting Wnt signaling in cancers where conventional approaches targeting the canonical pathway may be ineffective.

For neurological applications, the specific expression of Fzd10 in the developing cortex and hippocampus suggests potential for targeting neurodevelopmental disorders with minimal off-target effects in other brain regions.

What are the potential causes and solutions for inconsistent results when studying Frizzled-10 signaling in different model systems?

Inconsistent results when studying Frizzled-10 signaling across different model systems can arise from multiple sources. Understanding these variables and implementing appropriate controls can help researchers troubleshoot and obtain more reliable data.

Potential Causes of Inconsistency:

Methodological Approaches to Ensure Consistency:

  • Standardized expression systems: Utilize the same expression vector backbone and promoter across different cell types; consider using Mouse Frizzled-10 VersaClone cDNA as a standardized resource.

  • Comprehensive pathway analysis: Rather than relying on a single readout (e.g., TOPFlash), examine multiple nodes in the signaling cascade, including:

    • β-catenin stabilization and nuclear localization

    • Target gene expression (AXIN2, LEF1)

    • Non-canonical pathway markers (Ca²⁺ flux, JNK activation)

  • Genetic background considerations: When comparing results between different mouse strains or cell lines, be aware that genetic background can significantly influence Wnt pathway responses. Using isogenic cell lines can minimize this variability.

  • Positive and negative controls: Include well-characterized Frizzled receptors with known signaling properties (e.g., Fzd1 for canonical signaling) as benchmarks for comparison.

  • Validation across models: Confirm key findings in multiple models, moving from cell lines to primary cells to in vivo systems when possible. The Frizzled10-Cre mouse line can be particularly valuable for in vivo validation of mechanisms identified in vitro.

The apparent contradiction between Fzd10's role in canonical Wnt signaling during development and its inverse correlation with β-catenin nuclear accumulation in colorectal cancer highlights how context-dependent Fzd10 signaling can be, underscoring the importance of comprehensive pathway analysis.

How can researchers accurately interpret seemingly contradictory data on Frizzled-10 function across different developmental contexts?

Interpreting seemingly contradictory data on Frizzled-10 function across different developmental contexts requires a nuanced approach that considers multiple factors influencing receptor function. Researchers should implement the following interpretive framework:

The apparent contradiction between Fzd10's ability to promote canonical Wnt signaling in developmental contexts (as seen in the chick spinal cord) versus the inverse correlation with β-catenin nuclear accumulation in colorectal cancer exemplifies how cellular context can dramatically alter receptor function. Rather than viewing these as contradictory results, researchers should interpret them as evidence of Fzd10's versatility and context-dependent signaling capabilities.

What technical challenges are associated with detecting endogenous Frizzled-10 protein, and how can they be overcome?

Detecting endogenous Frizzled-10 protein presents several technical challenges due to its structure, expression characteristics, and the limitations of available tools. Researchers can employ the following strategies to overcome these obstacles:

Common Challenges and Solutions:

ChallengeExplanationSolution Strategies
Low expression levelsEndogenous Fzd10 is often expressed at low levels in many tissuesUse signal amplification methods (TSA, HRP-conjugated secondary antibodies); Employ more sensitive detection methods (enhanced chemiluminescence)
Antibody specificity issuesHigh homology between Frizzled family members can lead to cross-reactivityValidate antibodies using knockout controls; Use epitope-tagged knockin mice; Consider alternative detection methods (RNA scope, proximity ligation assays)
Membrane protein detectionMembrane proteins like Fzd10 can be difficult to extract and detectOptimize extraction buffers with appropriate detergents; Use membrane fractionation techniques; Perform cell surface biotinylation followed by pull-down
Post-translational modificationsModifications may mask epitopes or alter migration patternsUse multiple antibodies targeting different epitopes; Treat samples with deglycosylation enzymes before analysis
Spatial resolution limitationsDetermining precise subcellular localization can be challengingEmploy super-resolution microscopy techniques; Use electron microscopy with immunogold labeling

Advanced Detection Methods:

  • Proximity Ligation Assay (PLA):

    • This technique has been successfully used to detect interactions between Fzd10 and its ligands WNT1 and WNT3A

    • PLA provides higher sensitivity than conventional immunofluorescence and can detect proteins at endogenous levels

  • Genetic Tagging Approaches:

    • CRISPR-Cas9 mediated knockin of small epitope tags or fluorescent proteins

    • Generation of transgenic reporter lines, similar to the Frizzled10-Cre line but with fluorescent protein reporters instead of Cre

  • Mass Spectrometry-Based Approaches:

    • Targeted proteomics using selected reaction monitoring (SRM) or parallel reaction monitoring (PRM)

    • Sample preparation using immunoprecipitation to enrich for Fzd10 before mass spectrometry analysis

  • Single-Molecule Detection Methods:

    • Single-molecule RNA FISH to correlate protein detection with mRNA expression

    • Single-molecule imaging techniques to visualize trafficking and clustering of individual receptor molecules

  • Alternative Expression Readouts:

    • Use of well-characterized downstream targets as indirect readouts of Fzd10 activity

    • Reporter mice that express fluorescent proteins under the control of the endogenous Fzd10 promoter

By combining these approaches and including appropriate controls, researchers can overcome the technical limitations associated with detecting endogenous Fzd10 and obtain reliable data on its expression, localization, and function in various developmental and disease contexts.

How should researchers approach the investigation of Frizzled-10 in neural stem cell-based regenerative medicine applications?

Investigating Frizzled-10 in neural stem cell-based regenerative medicine requires a systematic approach that spans from basic mechanistic understanding to translational applications. Researchers should consider the following framework:

  • Characterization of Fzd10 Expression in Neural Stem Cell Populations:

    • Determine Fzd10 expression levels in different neural stem/progenitor populations

    • Map expression changes during differentiation trajectories

    • Compare expression in embryonic versus adult neural stem cell niches

  • Functional Analysis in Neural Stem Cell Self-Renewal and Differentiation:

    • Leverage the established role of Fzd10 in neural progenitor proliferation

    • Investigate how Fzd10-mediated signaling affects fate decisions of neural stem cells

    • Determine the impact on migration and integration of newly generated neurons

  • Manipulation of Fzd10 Signaling for Therapeutic Purposes:

    • Develop strategies to activate or inhibit Fzd10 signaling in a controlled manner

    • Test small molecules, biologics, or genetic approaches to modulate Fzd10 activity

    • Establish dose-response relationships and temporal windows for intervention

  • Translation to Disease Models:

    • Test Fzd10-based interventions in models of neurodegenerative diseases or brain injury

    • Assess effects on endogenous neural stem cell activation and repair

    • Evaluate Fzd10 modulation in combination with cell transplantation approaches

  • Development of Scalable and Clinically Relevant Protocols:

    • Optimize conditions for ex vivo expansion of neural stem cells with controlled Fzd10 signaling

    • Develop GMP-compatible methods for potential clinical translation

    • Establish quality control metrics based on Fzd10-dependent outcomes

The specific expression of Fzd10 in the developing dorsal telencephalon and its confinement to pyramidal cell fields in the adult hippocampus makes it an attractive target for applications focused on cortical and hippocampal repair. The Frizzled10-Cre mouse line provides a valuable tool for preclinical studies, enabling selective manipulation of genes in Fzd10-expressing neural progenitors to enhance their regenerative potential.

Researchers should be mindful of the context-dependent nature of Fzd10 signaling, as evidenced by its ability to activate different downstream pathways depending on the cellular environment. This versatility may be advantageous for regenerative applications if properly understood and controlled.

What considerations are important when developing therapeutic agents targeting Frizzled-10 for neurological disorders?

Developing therapeutic agents targeting Frizzled-10 for neurological disorders requires careful consideration of several factors to ensure efficacy, specificity, and safety. The following considerations are essential:

  • Target Validation and Disease Relevance:

    • Confirm altered Fzd10 expression or function in specific neurological disorders

    • Establish causal relationships between Fzd10 dysregulation and disease phenotypes

    • Determine if targeting Fzd10 addresses disease mechanisms or merely symptoms

  • Receptor Specificity:

    • Design agents with high selectivity for Fzd10 over other Frizzled family members

    • Consider the high structural homology in the cysteine-rich domains of Frizzled receptors

    • Develop screening assays to assess cross-reactivity with other Frizzled receptors

  • Pathway Selectivity:

    • Determine whether to target canonical or non-canonical signaling downstream of Fzd10

    • Design agents that can differentiate between different modes of Fzd10 signaling

    • Consider the complex regulation of Wnt signaling and potential compensatory mechanisms

  • Brain Penetration and Delivery:

    • Address blood-brain barrier penetration for systemically administered agents

    • Consider alternative delivery routes (intrathecal, intranasal, direct brain infusion)

    • Explore viral vector-mediated approaches for genetic modulation of Fzd10

  • Developmental and Regional Considerations:

    • Leverage the specific expression pattern of Fzd10 in the dorsal telencephalon

    • Consider potential developmental roles when targeting disorders with neurodevelopmental components

    • Be aware of potential off-target effects in other Fzd10-expressing tissues

  • Therapeutic Agent Modalities:

    • Antibodies: High specificity but challenging BBB penetration

    • Small molecules: Better BBB penetration but potentially lower specificity

    • Peptides: Can target specific interaction interfaces

    • Genetic approaches: High specificity but delivery challenges

  • Preclinical Model Selection:

    • Utilize the Frizzled10-Cre mouse line for genetic proof-of-concept studies

    • Develop disease-specific models that recapitulate Fzd10-related pathology

    • Consider species differences in Fzd10 expression and function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.