Recombinant Mouse Frizzled-1 (Fzd1)

Shipped with Ice Packs
In Stock

Description

Biological Role and Mechanism

Fzd1 mediates canonical Wnt/β-catenin signaling by:

  1. Binding Wnt ligands (e.g., Wnt3a, Wnt3, Wnt1) via its CRD .

  2. Recruiting Dishevelled proteins to inhibit GSK-3 kinase, stabilizing β-catenin for nuclear translocation .

  3. Modulating non-canonical pathways (e.g., PKC/calcium signaling) .

Recombinant Fzd1 is used to study these pathways in vitro and in vivo, particularly in contexts like cardiac hypertrophy .

Cardiac Hypertrophy and Therapeutic Potential

  • Upregulation in Hypoxia: Fzd1 expression increases in hypoxic cardiomyocytes and post-myocardial infarction (MI) heart tissue .

  • Mechanism of Action: Recombinant Fzd1 protein (RFP) induces anti-Fzd1 antibodies, blocking canonical Wnt signaling and attenuating hypertrophy .

  • Outcomes:

    • Reduced left ventricular (LV) hypertrophy and β-myosin heavy chain expression.

    • Improved cardiac function in MI models .

Detection and Quantification

MethodApplicationSensitivitySample Types
ELISA (Assay Genie)Quantify Fzd1 in serum/plasma0.39 ng/mLSerum, plasma, tissue homogenates
Western BlotDetect Fzd1 in recombinant proteinNot specifiedRecombinant Fzd1, cell lysates
IHCLocalize Fzd1 in tissue sectionsNot specifiedEmbryonic intestine, heart

Sources:

Key Research Discoveries

  1. Cardiac Hypertrophy: Fzd1 inhibition via RFP reduces β-catenin levels and hypertrophic markers (e.g., β-MHC) .

  2. Wnt Signaling Modulation: Recombinant Fzd1 blocks canonical pathways in hypoxic cardiomyocytes, confirming its role in stress responses .

  3. Therapeutic Strategy: Immunization with RFP induces durable anti-Fzd1 antibodies, offering a novel approach to treat MI-related hypertrophy .

Challenges and Future Directions

  • Bioactivity Validation: Many recombinant Fzd1 products lack validated bioactivity, limiting functional studies .

  • Tissue-Specific Effects: Further research is needed to clarify Fzd1’s role in distinct organs (e.g., brain vs. heart) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
Fzd1; Frizzled-1; Fz-1; mFz1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
69-642
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
VRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGISIPDHGYCQPISIPLCTDIAYNQTI MPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCER ARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQH GGGGYRGGYPGGAGTVERGKFSCPRALRVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGP EELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGF LLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGM KWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLA PLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVIA CYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQGGGGVPPHPPMSPDFTVFMIKYLMTLIV GITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
Uniprot No.

Target Background

Function
Frizzled-1 (Fzd1) acts as a receptor for Wnt proteins. It is activated by WNT7B, WNT3A, WNT3, WNT1, and to a lesser extent by WNT2, but not by WNT4, WNT5A, WNT5B, WNT6, WNT7A, or WNT7B (contradictory results regarding activation by WNT7B have been reported for mouse). Fzd1 plays a crucial role in the canonical Wnt/beta-catenin signaling pathway, which ultimately leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. A secondary signaling pathway involving PKC and calcium fluxes has been observed for some family members, but it remains unclear whether this represents a distinct pathway or is integrated within the canonical pathway, as PKC appears necessary for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Fzd1 may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (probable).
Gene References Into Functions
  1. FZD1 regulates specific stages of adult hippocampal neurogenesis. PMID: 26980182
  2. Suppressed expression of Fzd1 in myogenic cells from aged mice results in a significant increase in myogenic differentiation, and its forced expression in those from young mice results in its drastic inhibition. PMID: 24475942
  3. The results indicate the involvement of Wnt1 and Fzd1 in the pathogenesis and development of amyotrophic lateral sclerosis. PMID: 23553522
  4. Results indicate that frizzled homolog 1(Drosophila)(Fzd1) is required for normal female fertility and may act in part to regulate oocyte maturation and cumulus cell function. PMID: 22954793
  5. Wnt/Fzd signaling is involved in balancing the inflammatory response to microbial stimulation of innate immune cells of vertebrate origin. PMID: 20667980
  6. Frizzled signaling is involved in diverse tissue closure processes, defects in which account for some of the most common congenital anomalies. PMID: 20940229
  7. Indicate that myofibroblast migration and differentiation are modulated via Wnt/Fzd signalling. PMID: 20189955
  8. Fz-1 is expressed at distinct stages of follicular development. PMID: 11861511
  9. Frizzled-1 is an antagonist of the canonical Wnt/beta-catenin signaling pathway. PMID: 14627707
  10. Data demonstrate that Wnt7b signals through Fzd1 and -10 and LRP5 and implicate these Wnt coreceptors in the regulation of lung airway and vascular development. PMID: 15923619
  11. Fzd1 transcription increased during pulmonary fibrosis in mice. PMID: 17496152

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in chondrocytes.

Q&A

What is Mouse Frizzled-1 (FZD1) and what is its biological significance?

Basic Research Question

Mouse Frizzled-1 (FZD1) is a member of the G-protein-coupled receptor superfamily that serves as a critical receptor in the Wnt signaling pathway. FZD1 functions as a co-receptor with LRP-5 for Wnt ligands, mediating signal transduction in multiple cellular processes . The protein structure includes:

  • A signal peptide

  • A cysteine-rich domain in the N-terminal extracellular region

  • Seven transmembrane domains

  • A C-terminal PDZ domain-binding motif

FZD1 plays significant roles in embryonic development, tissue homeostasis, and various pathological conditions. Recent research has identified its importance in cardiac remodeling after myocardial infarction, where it contributes to the development of cardiac hypertrophy .

How is Recombinant Mouse Frizzled-1 protein produced for research applications?

Basic Research Question

Recombinant Mouse Frizzled-1 can be produced using various expression systems, with the choice depending on experimental requirements. Production typically involves:

Expression SystemAdvantagesCommon Applications
Human Cells (HEK 293)Post-translational modifications similar to native proteinFunctional studies, binding assays
NS0 CellsMammalian glycosylation patternsBinding activity studies
Mammalian expression systemsProper protein folding and glycosylationGeneration of Fc-chimeric proteins

The production process generally includes:

  • Cloning the target gene encoding a specific fragment (typically Val69-His248 portion) into an expression vector

  • Transfecting host cells with the construct

  • Expressing the protein with appropriate tags (e.g., His-tag or Fc-tag)

  • Purifying the protein to >95% purity

  • Formulating in appropriate buffers (typically PBS, pH 7.4)

  • Lyophilizing for storage and stability

What are the structural characteristics of commercially available Recombinant Mouse Frizzled-1?

Basic Research Question

Commercial Recombinant Mouse Frizzled-1 proteins are engineered with specific structural features to enhance functionality and stability in experimental settings:

CharacteristicDetailsRelevance
Amino Acid SequenceTypically Val69-His248 of the native proteinRepresents the functional extracellular domain
Molecular Mass~46.8 kDa (theoretical)Important for verification by SDS-PAGE
Apparent Molecular Mass35-40 kDaMay differ from theoretical due to glycosylation
Fusion TagsC-terminal Fc tag or His tagFacilitates purification and detection
Purity>95% as determined by SDS-PAGEEnsures experimental reliability
Endotoxin Level<1.0 EU per μgCritical for in vivo applications

The extracellular domain containing the cysteine-rich region is particularly important as it serves as the binding site for Wnt ligands, making it crucial for studies involving Wnt signaling pathway interactions .

What are the optimal storage and handling conditions for Recombinant Mouse Frizzled-1?

Basic Research Question

Proper storage and handling of Recombinant Mouse Frizzled-1 is essential for maintaining its biological activity:

FormStorage TemperatureDuration of Stability
Lyophilized-20°C to -80°CUp to 12 months
Reconstituted solution4-8°C2-7 days
Aliquoted reconstituted samples<-20°C3 months

Methodological recommendations:

  • Reconstitute lyophilized protein in sterile, filtered PBS or manufacturer-recommended buffer

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots immediately after reconstitution

  • When thawing frozen aliquots, use gentle agitation and maintain at 4°C

  • Work quickly and keep the protein on ice during experimental setup

  • If studying binding properties, consider the presence of protein carrier or stabilizers in the formulation that might affect experimental outcomes

Following these guidelines will help ensure experimental reproducibility and maintain the protein's functional properties.

How is FZD1 expression regulated in cardiac tissue during ischemia?

Advanced Research Question

FZD1 expression undergoes significant upregulation in cardiac tissue following ischemic insult, as demonstrated by both in vivo and in vitro studies:

In vivo regulation:

  • FZD1 mRNA levels increase approximately 3.6-fold in the infarct border zone of mouse left ventricles one week after myocardial infarction (MI)

  • Protein expression increases by approximately 4.6-fold in the same region

  • This upregulation appears to be cardiac-specific, as no significant changes in FZD1 expression are observed in brain, lung, liver, or muscle following MI

In vitro regulation:

  • In neonatal rat cardiomyocytes (NRCMs), hypoxic conditions (mimicking ischemia) induce a 5.2-fold increase in FZD1 mRNA levels

  • Protein expression increases by approximately 6.0-fold under hypoxic conditions

This ischemia-induced upregulation of FZD1 appears to be a critical mediator in the development of cardiac hypertrophy following MI, suggesting its potential as a therapeutic target .

What experimental models are suitable for studying FZD1 function in cardiovascular research?

Advanced Research Question

Several experimental models have been validated for investigating FZD1 function in cardiovascular research:

In vivo models:

  • Myocardial infarction (MI) mouse model:

    • Induced by left anterior descending (LAD) coronary occlusion

    • Allows study of FZD1 expression in the infarct border zone of left ventricles

    • Enables assessment of cardiac hypertrophy and function following MI

  • Auto-immunization model:

    • Subcutaneous injection of recombinant FZD1 protein (RFP) in mice

    • Typically administered twice (day 1 and day 7)

    • Induces production of FZD1-specific antibodies

    • Allows study of FZD1 inhibition effects on cardiac hypertrophy and function

In vitro models:

  • Neonatal rat cardiomyocytes (NRCMs):

    • Cultured under hypoxic conditions to mimic ischemia

    • Enables study of FZD1 expression and hypertrophic response

    • Suitable for siRNA transfection to silence FZD1

  • Cardiomyocyte surface area measurement:

    • Immunostaining with α-Myosin heavy chain (α-MHC) antibody

    • Quantification of cell surface area as an indicator of hypertrophy

These models provide complementary approaches to understand FZD1's role in cardiac pathophysiology and validate it as a potential therapeutic target.

How does Recombinant Frizzled-1 protein attenuate cardiac hypertrophy after myocardial infarction?

Advanced Research Question

Recombinant Frizzled-1 protein (RFP) attenuates cardiac hypertrophy after myocardial infarction through an auto-immunization mechanism that ultimately inhibits the canonical Wnt signaling pathway:

  • Auto-antibody production mechanism:

    • Subcutaneous injection of RFP triggers recognition by immune cells as an alloantigen

    • This stimulates B-cells to produce FZD1-specific antibodies

    • Repeated injections enhance antibody production through a memory effect

  • Effects on endogenous FZD1:

    • The circulating anti-FZD1 antibodies bind to transmembrane FZD1 receptors in cardiac tissue

    • This binding inhibits the expression of endogenous FZD1 in the ischemic heart tissue

    • The inhibition shows remarkable tissue specificity for the heart, with no significant effects on FZD1 expression in other organs

  • Downstream signaling effects:

    • Inhibition of endogenous FZD1 suppresses canonical Wnt signaling pathway activation

    • This includes restraining β-catenin and glycogen synthase kinase-3β activation in left ventricles

    • The inhibition of this pathway ultimately suppresses cardiac hypertrophy

These findings highlight RFP's potential as an immunotherapeutic strategy for treating cardiac hypertrophy after MI, offering longer-lasting effects than direct antibody injections due to the immune system's memory effect .

What mechanisms underlie the auto-immunization response against FZD1 when using Recombinant Frizzled-1 protein?

Advanced Research Question

The auto-immunization response against FZD1 involves several immunological mechanisms:

  • Antigen recognition:

    • Recombinant FZD1 protein is recognized as an alloantigen by immunocytes

    • The protein is processed and presented to T-cells and B-cells

  • Antibody production:

    • B-cells activated by RFP produce FZD1-specific antibodies

    • In studies, this has resulted in a 4.7-fold and 4.9-fold increase in plasma concentration of FZD1 autoantibodies in sham and MI mice, respectively

  • Memory effect enhancement:

    • Repeated injection of RFP (at day 1 and day 7) activates the immunological memory

    • This dramatically shortens the time required for mounting an immune response and increases antibody production

  • Target binding and inhibition:

    • Unlike intracellular proteins, FZD1's transmembrane nature allows easy binding of circulating antibodies

    • The binding of antibodies to FZD1 in cardiac tissue leads to significant reduction in endogenous FZD1 expression

    • This inhibition was observed specifically in MI mice but not in sham-operated mice, suggesting a context-dependent mechanism

  • Tissue specificity:

    • The inhibitory effect shows remarkable tissue specificity for the heart

    • No significant changes in FZD1 expression were observed in brain, lung, liver, or muscle in MI mice after RFP treatment

This auto-immunization approach represents a novel therapeutic strategy with potentially fewer side effects due to its tissue specificity and longer-lasting effects through immune memory activation .

How can FZD1 silencing techniques be optimized for in vitro cardiomyocyte studies?

Advanced Research Question

Optimizing FZD1 silencing in cardiomyocyte studies requires careful consideration of several methodological aspects:

  • siRNA design and transfection:

    • Evidence from neonatal rat cardiomyocytes (NRCMs) studies demonstrates effective silencing of FZD1 using siRNA transfection

    • Optimal transfection should achieve significant reduction in both mRNA and protein levels of FZD1

  • Validation of silencing efficiency:

    • Western blot analysis should be used to confirm reduction in FZD1 protein expression

    • Quantitative comparison between control and FZD1-silenced cardiomyocytes should show statistically significant reduction

  • Experimental timing:

    • For hypoxia studies, introduce hypoxic conditions after confirming successful FZD1 silencing

    • A 24-hour hypoxia exposure has been shown to effectively induce cardiomyocyte hypertrophy

  • Functional readouts:

    • Cardiomyocyte surface area (CSA) measurement using α-MHC immunostaining provides a reliable indicator of hypertrophic response

    • β-MHC mRNA level quantification serves as a molecular marker of hypertrophy

    • TUNEL assay can be used to assess whether FZD1 silencing affects cardiomyocyte apoptosis

Key experimental findings to validate methodology:

  • In published studies, hypoxia induced a 2.2-fold increase in cardiomyocyte surface area and an 8.1-fold increase in β-MHC mRNA levels

  • FZD1 siRNA significantly repressed these increases, confirming effective silencing

  • Notably, FZD1 silencing did not alter hypoxia-induced cell apoptosis (2.5-fold increase remained unchanged), indicating specificity for hypertrophic pathways rather than cell death mechanisms

These methodological considerations ensure reliable assessment of FZD1's role in hypoxia-induced cardiac hypertrophy.

What is the relationship between FZD1 inhibition and canonical Wnt signaling in cardiomyocytes?

Advanced Research Question

FZD1 inhibition has significant effects on canonical Wnt signaling in cardiomyocytes, particularly in the context of ischemia-induced cardiac hypertrophy:

  • FZD1's role in Wnt signaling:

    • FZD1 functions as a co-receptor with LRP-5 for Wnt ligands

    • It mediates signal transduction through the canonical Wnt pathway

  • Effects of FZD1 inhibition on canonical Wnt signaling components:

    • Inhibition of FZD1 (either by RFP-induced auto-antibodies or siRNA) restrains activation of β-catenin, a key mediator of canonical Wnt signaling

    • Glycogen synthase kinase-3β (GSK-3β) activation is also inhibited

    • These effects were observed both in vivo in MI mice treated with RFP and in vitro in hypoxic NRCMs transfected with FZD1 siRNA

  • Mechanistic pathway:

    • Under normal conditions, FZD1 activation by Wnt ligands leads to inhibition of GSK-3β

    • This inhibition prevents β-catenin phosphorylation and degradation

    • Accumulated β-catenin translocates to the nucleus and activates transcription factors

    • FZD1 inhibition reverses this process, promoting β-catenin degradation and reducing Wnt target gene expression

  • Functional consequences:

    • By blocking canonical Wnt signaling, FZD1 inhibition significantly attenuates cardiac hypertrophy

    • This effect appears to be independent of effects on myocardial survival or apoptosis

    • The specificity of this pathway intervention makes it a promising therapeutic target

These findings collectively establish FZD1 as an essential mediator of cardiac hypertrophy induced by hypoxic stimuli through its regulation of canonical Wnt signaling.

How can the purity and biological activity of Recombinant Mouse Frizzled-1 be verified?

Advanced Research Question

Verifying the purity and biological activity of Recombinant Mouse Frizzled-1 requires multiple analytical and functional approaches:

Purity verification:

  • SDS-PAGE analysis:

    • High-quality Recombinant Mouse Frizzled-1 should exhibit >95% purity

    • The apparent molecular mass should be 35-40 kDa on SDS-PAGE

    • This may differ from the theoretical molecular mass (46.8 kDa) due to glycosylation patterns

  • Endotoxin testing:

    • The LAL (Limulus Amebocyte Lysate) method should confirm endotoxin levels <1.0 EU per μg

    • This is particularly important for in vivo applications

Biological activity assessment:

  • Binding assays:

    • Evaluate binding to natural Wnt ligands

    • The Recombinant Mouse Frizzled-1 Fc Chimera has been validated for binding activity

  • Immunological response verification:

    • When used for auto-immunization studies, the production of specific anti-FZD1 antibodies in plasma should be quantified

    • Successful immunization typically results in a 4-5 fold increase in antibody titers

  • Functional inhibition assay:

    • Assess the protein's ability to reduce endogenous FZD1 expression in target tissues

    • In cardiac studies, this can be verified by measuring FZD1 mRNA and protein levels in the infarct border zone of mouse left ventricles

  • Downstream signaling analysis:

    • Evaluate effects on canonical Wnt signaling components (β-catenin, GSK-3β)

    • Effective Recombinant Mouse Frizzled-1 should modulate these pathways when used in auto-immunization approaches

These verification methods ensure experimental reliability and reproducibility when working with Recombinant Mouse Frizzled-1.

What are the key considerations for designing experiments with Recombinant Mouse Frizzled-1?

Advanced Research Question

Designing robust experiments with Recombinant Mouse Frizzled-1 requires careful attention to several critical factors:

  • Experimental model selection:

    • In vivo: Consider mouse models of myocardial infarction (MI) using left anterior descending (LAD) coronary occlusion

    • In vitro: Neonatal rat cardiomyocytes (NRCMs) under hypoxic conditions provide a controlled environment

  • Administration protocol for immunization studies:

    • Timing: Two subcutaneous injections - initial injection followed by a booster on day 7

    • Surgical intervention (e.g., MI induction) should be performed approximately 21 days after the first injection

    • Sample collection at appropriate time points (typically one week after surgery)

  • Control groups design:

    • Include both sham-operated and MI groups with and without RFP treatment

    • Validate responses in multiple tissues to assess specificity (heart, brain, lung, liver, muscle)

  • Measurement parameters:

    • Antibody titers: Quantify plasma concentration of FZD1 autoantibody

    • Target inhibition: Measure FZD1 mRNA and protein levels

    • Physiological outcomes: Assess heart and LV weights, myocardial size

    • Molecular markers: Measure β-myosin heavy chain expression

    • Functional readouts: Evaluate cardiac function parameters

  • Pathway analysis:

    • Include assessment of canonical Wnt signaling components (β-catenin, GSK-3β)

    • Consider the effects on both upstream and downstream signaling molecules

  • Technical considerations:

    • Protein stability: Follow storage recommendations to maintain activity

    • Reconstitution: Use appropriate buffers and avoid contamination

    • Aliquoting: Prepare single-use aliquots to avoid freeze-thaw cycles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.