Recombinant Mouse Frizzled-2 (Fzd2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag is determined during production. Please inform us of any tag preferences for prioritized development.
The specific tag is determined during production. Please inform us of any tag preferences for prioritized development.
Synonyms
Fzd2; Fzd10; Frizzled-2; Fz-2; mFz2; Frizzled-10; Fz-10; mFz10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-570
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQ
CSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPR
HGAEQICVGQNHSEDGAPALLTTAPPSGLQPGAGGTPGGPGGGGSPPRYATLEHPFHCPR
VLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTV
TTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTK
KEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVK
TITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRT
IMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLA
IPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHGET
TV
Uniprot No.
Target Background
Function
Frizzled-2 (Fzd2) is a receptor for Wnt proteins. Most Fzd receptors are coupled to the canonical beta-catenin signaling pathway, activating disheveled proteins, inhibiting GSK-3 kinase, promoting nuclear beta-catenin accumulation, and activating Wnt target genes. A secondary pathway involving PKC and calcium fluxes has been observed in some family members. The relationship between this pathway and the canonical pathway remains unclear, although PKC appears necessary for Wnt-mediated GSK-3 kinase inactivation. Both pathways appear to involve G-protein interactions. Fzd2 may play a role in transducing and transmitting polarity information during tissue morphogenesis and in differentiated tissues.
Gene References Into Functions
- Fzd2 influences changes in epithelial cell length and shape, contributing to lung epithelial tube branching morphogenesis and maintenance. PMID: 25114215
- Genetic interactions were observed between Fzd2 and Fzd7, and five canonical and/or non-canonical signaling molecules: Dvl3, Wnt3a, Wnt11, Vangl2, and Wnt5a. PMID: 23095888
- Frizzled signaling is involved in various tissue closure processes; defects contribute to common congenital anomalies. PMID: 20940229
- Myofibroblast migration and differentiation are modulated via Wnt/Fzd signaling. PMID: 20189955
- Fzd2 shows preferential expression in fetal liver kinase (Flk)1-negative and Flk1-positive cells under varying culture conditions. PMID: 17154359
Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in embryonic and adult heart, lung, chondrocytes and brain. Also expressed in the developing gastrointestinal tract (strongest in foregut), much weaker expression in the adult. No expression in fetal liver and adult spleen. Up-regulated in esoph
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
