Recombinant Mouse Frizzled-3 (Fzd3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Frizzled-3 (Fzd3)

Recombinant Mouse Frizzled-3 (Fzd3) serves as a key receptor protein within the Frizzled family, functioning primarily as a receptor for Wnt proteins. As a member of the FZD3/6 subfamily, it exhibits distinct structural and functional characteristics compared to other Frizzled receptors . The production of recombinant forms of this protein has significantly advanced our understanding of its biological functions, particularly in brain axonal development and cancer progression . Fzd3 plays an essential role in the Wnt signaling pathway, which is critical for embryonic development and tissue homeostasis throughout the organism's lifespan.

Dysregulation of the Wnt pathway, including abnormal Fzd3 function, has been implicated in various pathological conditions, including cancer, neurodegenerative disorders, and developmental abnormalities . This makes Fzd3 not only an important subject for basic research but also a promising target for therapeutic interventions. The availability of recombinant forms of this protein has accelerated research efforts in both directions, enabling detailed structural studies and functional analyses that were previously challenging with naturally occurring proteins.

Domain Organization

Recombinant Mouse Frizzled-3 possesses a complex multi-domain architecture that facilitates its function in Wnt signal transduction. The protein structure includes an extracellular cysteine-rich domain (CRD) that serves as the primary binding site for Wnt ligands, a flexible linker region connecting the CRD to the transmembrane portion, a transmembrane domain (TMD) consisting of seven helices that adopts a G-protein coupled receptor (GPCR)-like fold, and intracellular regions that interact with downstream signaling components . This organization allows Fzd3 to receive extracellular signals and transmit them across the cell membrane to initiate intracellular signaling cascades.

The domain arrangement of Fzd3 is fundamental to its function, with each component playing a specific role in signal recognition and transduction. The extracellular CRD recognizes and binds Wnt ligands, the transmembrane domain anchors the receptor in the cell membrane and participates in conformational changes during signaling, while the intracellular regions interact with cytoplasmic signaling proteins such as Dishevelled (DVL) and G proteins to propagate the signal within the cell .

Cryo-EM Structure Revelations

Cryo-electron microscopy (cryo-EM) has further enhanced our understanding of full-length Fzd3 structure. The cryo-EM structure reveals partially resolved density for the CRD, which exhibits positional flexibility relative to the TMD . This flexibility may be important for accommodating different ligands and facilitating conformational changes during signaling. The transmembrane conformation of Fzd3 resembles that of active GPCRs, suggesting a mechanism for signal transduction across the cell membrane .

The structural data obtained through cryo-EM also reveals potential binding sites for intracellular signaling partners. Specifically, the cytoplasmic region includes binding sites for Dishevelled and G proteins, which are essential components of the Wnt signaling cascade . These structural insights provide a foundation for understanding how Fzd3 functions at the molecular level and how it might be targeted for therapeutic purposes.

Canonical and Non-Canonical Pathways

Recombinant Mouse Frizzled-3 functions as a receptor for Wnt proteins and participates in both canonical (β-catenin dependent) and non-canonical (β-catenin independent) Wnt signaling pathways . In the canonical pathway, Fzd3 activation leads to the stimulation of Dishevelled proteins, inhibition of GSK-3 kinase, nuclear accumulation of β-catenin, and subsequent activation of Wnt target genes . This pathway is critical for numerous developmental processes and tissue homeostasis.

Role in Development and Disease

Fzd3 plays critical roles in development, particularly in brain axonal development . The protein is essential for proper neuronal connectivity and axon guidance during embryonic development. Disruptions in Fzd3 function can lead to developmental abnormalities, particularly in the nervous system . This makes Fzd3 a crucial factor in understanding neurodevelopmental disorders and potentially developing treatments for them.

In addition to its developmental roles, Fzd3 has been implicated in various pathological conditions. Aberrant Fzd3 expression or function contributes to cancer progression in multiple tumor types . The involvement of Fzd3 in cancer makes it a potential target for anticancer therapies. Furthermore, alterations in Wnt signaling via Fzd3 may play a role in neurodegenerative processes, suggesting potential applications in treating neurodegenerative disorders .

Extracellular Binding Nanobodies

Recent research has identified specific nanobodies that interact with Fzd3, providing valuable tools for studying its function and potentially developing therapeutic interventions . Nanobody 8 (Nb8) has been found to bind specifically to the CRD of Fzd3 with high affinity (Kd = 19.2 ± 1.2 nM), showing much weaker binding to the related FZD6 CRD (Kd = 1200 ± 200 nM) and no binding to other FZD CRDs . This high degree of specificity makes Nb8 a valuable tool for targeting Fzd3 in research and potential therapeutic applications.

The crystal structure of the Fzd3 CRD-Nb8 complex reveals that Nb8 binds at the base of the lipid-binding groove using a concave surface formed by its complementarity-determining regions (CDRs) . This binding interaction can compete with Wnt5a, suggesting a potential mechanism for modulating Wnt signaling . Interestingly, Nb8 fused with the Dickkopf-1 C-terminal domain behaves as a FZD3-specific Wnt surrogate, activating β-catenin signaling . This demonstrates the potential for engineered proteins to mimic or modify Fzd3 function.

Intracellular Binding Nanobodies

In addition to extracellular binding nanobodies, researchers have identified nanobodies that interact with the intracellular regions of Fzd3. Nanobody 9 (Nb9) binds to the cytoplasmic region of Fzd3 at the putative Dishevelled or G protein-binding site with high affinity (Kd = 32 ± 2.8 nM) . This interaction competes with DVL binding and inhibits GαS coupling, providing a tool for manipulating Fzd3-mediated signaling .

The identification of both extracellular and intracellular binding nanobodies provides a comprehensive toolkit for modulating Fzd3 function at different levels. Extracellular binding nanobodies can interfere with or mimic ligand binding, while intracellular binding nanobodies can modulate downstream signaling events. These tools not only enhance our understanding of Fzd3 function but also offer potential therapeutic strategies for conditions involving dysregulated Wnt signaling.

Wnt Ligand Interactions

Structural and binding studies suggest that Fzd3 exhibits specificity for certain Wnt ligands. The unique structural features of the Fzd3 CRD, including its narrower lipid-binding groove, likely contribute to this specificity . Superposition of the FZD3 CRD-Nb8 complex with the FZD8 CRD-Wnt3 assembly suggests that the configuration of the lipid-binding groove in Fzd3 would impede access of the Wnt palmitoleic moiety in a manner different from other Frizzled receptors .

Additionally, the linker region connecting the CRD to the TMD may play a role in determining Wnt specificity. Multiple possible interactions have been identified between unique residues in the Fzd3 linker and specific regions of Wnt ligands such as Wnt5a . These interactions may contribute to the selective binding of certain Wnt ligands to Fzd3, influencing the specificity of downstream signaling events.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
Fzd3; Frizzled-3; Fz-3; mFz3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-666
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
HSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFLC ALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVD LNLVGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFA RYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRV ACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAGSVWWVILTITWFLAAVPKWGSE AIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGVCFVGLYDVDALRYFVLAPLCLY VVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIRIGVFSILYLVPLLVVIGCYFYE QAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILFLMKYLMALIVGIPSIFWVGSKK TCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHASS TQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPCSYRGMEERLPHGSMSRLTDHSR HSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIEEDGTSA
Uniprot No.

Target Background

Function
Frizzled-3 (FZD3) is a receptor for Wnt proteins. Most FZD3 receptors are coupled to the canonical Wnt/β-catenin signaling pathway, activating dishevelled proteins, inhibiting GSK-3 kinase, promoting β-catenin nuclear accumulation, and ultimately activating Wnt target genes. A second pathway involving PKC and calcium fluxes has been observed, but its relationship to the canonical pathway remains unclear, as PKC appears necessary for Wnt-mediated GSK-3 kinase inactivation. Both pathways appear to involve G-protein interactions. Wnt5A activation stimulates PKC activity through a G-protein-dependent mechanism. FZD3 plays crucial roles in transducing and transmitting polarity information during tissue morphogenesis and in differentiated tissues. It is involved in regulating early axon growth and guidance, essential for forming major central and peripheral fiber tracts. Specifically, FZD3 is required for the development of major central nervous system fiber tracts (including the anterior commissure, corpus callosum, thalamocortical, corticothalamic, nigrostriatal, corticospinal tracts, fasciculus retroflexus, mammillothalamic tract, medial lemniscus, and ascending spinal cord tracts) and peripheral nervous system axon growth in specific cranial and spinal motor neuron populations (e.g., facial branchiomotor, hypoglossal, phrenic nerves, and dorsal limb motor nerves). FZD3 also contributes to cranial neural crest cell migration, sensory information transmission from the trunk and limbs to the brain, and commissural sensory axon guidance along the anterior-posterior axis of the developing spinal cord (in a Wnt-dependent manner). In conjunction with FZD6, it participates in neural tube closure and regulates planar cell polarity (PCP) establishment, particularly in orienting asymmetric stereocilia bundles in inner ear auditory and vestibular sensory cells. Furthermore, FZD3 promotes neurogenesis by maintaining sympathetic neuroblasts in the cell cycle via a β-catenin-dependent mechanism.
Gene References Into Functions
  1. Sonic Hedgehog (Shh)-Smoothened signaling downregulates Shisa2, inhibiting Frizzled3 glycosylation and cell surface presentation in rodent commissural axon growth cones. PMID: 28885142
  2. Celsr3 and Fzd3 orchestrate the formation of a pioneer neuron and axon scaffold during embryogenesis, extending from the prethalamus to the ventral telencephalon and subcortex, guiding reciprocal corticothalamic fibers. PMID: 27170656
  3. Frizzled3 shapes the pattern of retinal bipolar cell (RBC) somas and dendrites, and the structural and functional connectivity between rods and RBCs, highlighting its role in retinal development. PMID: 27214687
  4. Temporal and spatial expression profiles of Frizzled 3 in the ovary during the estrous cycle have been reported. PMID: 26909900
  5. Celsr3 and Fzd3 enable immature neurons to respond to Wnt7, upregulating Jag1 and modulating neural progenitor cell fate timing via Notch activation. PMID: 26939553
  6. Frizzled3 controls axonal polarity and intermediate target entry during striatal pathway development. PMID: 26490861
  7. In Fz3(-/-) limbs, dorsal axons stall at a specific location in the nerve plexus, without rerouting. PMID: 24347548
  8. Wnt3a/Frizzled-3 signaling regulates neural crest cell proliferation and differentiation, and melanocyte precursor development. PMID: 24815018
  9. Fz3 and Fz6 have partially interchangeable roles in tissue polarity signaling for epithelial orientation and axon growth and guidance. PMID: 25294940
  10. Celsr2-3, Fzd3, and Vangl2 organize multicilia in individual cells (single-cell polarity). PMID: 25024228
  11. Celsr2-3 and Fzd3 regulate forebrain axonal navigation via mechanisms distinct from classical epithelial core planar cell polarity, requiring unidentified interacting partners. PMID: 25002511
  12. Several central nervous system axon tracts require Fz3 function from embryonic day 11.5, affecting dopaminergic, serotonergic, and optic tract axon pathfinding. PMID: 24799694
  13. Frizzled3 endocytosis is crucial for growth cone steering. PMID: 24305805
  14. Celsr3 and Fzd3 control the guidance and growth of enteric neuronal projections relative to the longitudinal and radial gut axes. PMID: 23478408
  15. Fz3 maintains a pool of dividing sympathetic precursors at early developmental stages. PMID: 21325504
  16. Fzd3 and Fzd6 deficiency causes severe midbrain morphogenesis defects. PMID: 19842188
  17. Mice lacking Frizzled3 exhibit anterior-posterior guidance defects in commissural axons after midline crossing, indicating Wnt-Frizzled signaling guides commissural axons along the spinal cord's anterior-posterior axis. PMID: 14671310
  18. In Vangl2 mutant (Looptail; Lp) inner ears, Fz3 and Fz6 accumulate normally but mislocalize at the cell surface. PMID: 16495441
  19. Fz3 and Vangl2 colocalization and interaction suggest novel PCP mechanisms in vertebrates. PMID: 16687519
Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cell surface. Apical cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the cortex, diencephalon, rostral brainstem and little or no staining is seen in the striatum or cerebellum. Expressed in both hair cells and supporting cells in the utricle, saccule, cristae and the organ of Corti in the inner ear (at protei

Q&A

What is the molecular structure of Recombinant Mouse Frizzled-3 and how does it compare to other Frizzled receptors?

Recombinant Mouse Frizzled-3 is a membrane protein that belongs to the Frizzled family of receptors. The N-terminal portion of Fzd3 contains a cysteine-rich domain (CRD) that shows approximately 50% amino acid identity to the corresponding region of the Drosophila frizzled gene product, which functions as a receptor for Wg/Wnt signals . This CRD contains at least ten cysteine residues with highly conserved spacing between them, which is characteristic of all Frizzled family members . Unlike secreted frizzled-related proteins (sFRPs) such as sFRP3, Fzd3 contains transmembrane and cytosolic domains necessary for signal transduction .

Functionally, Fzd3 shows redundancy with Fzd6 in certain contexts, particularly in controlling skin polarity, though they appear to work through non-identical mechanisms . This redundancy must be considered when designing experiments targeting either receptor individually.

What are the primary biological functions of Frizzled-3 in mouse development?

Frizzled-3 plays crucial roles in several developmental processes:

  • Neural Development: Fzd3, together with Celsr2 and Celsr3, controls forebrain axon guidance and wiring by acting in both axons and guidepost cells . Genetic evidence shows that inactivation of Fzd3 in specific brain regions results in defects in the anterior commissure (AC) and internal capsule (IC) .

  • Planar Cell Polarity (PCP): Fzd3 functions in the PCP pathway, which controls the orientation of structures such as hair follicles in relation to body axes. In mouse skin, Fzd3 works redundantly with Fzd6 to control hair follicle orientation .

  • Adult Neurogenesis: Studies have indicated roles for Wnt signaling components, including Frizzled receptors, in adult hippocampal neurogenesis, which is activity-dependent .

How does Frizzled-3 interact with Wnt ligands and what determines binding specificity?

Frizzled-3 interacts with Wnt ligands through its cysteine-rich domain (CRD). Studies have shown that Wnt3a binds to several secreted frizzled-related proteins (sFRPs) in the nanomolar range, suggesting similar binding affinities may exist for the CRD of Fzd3 . The interaction between Wnts and Frizzled receptors is facilitated by the fatty acyl moiety present on Wnt proteins, as revealed by X-ray crystallography studies of Xenopus Wnt8 with frizzled CRD .

Binding specificity between different Wnt ligands and Frizzled receptors is determined by structural complementarity of the interaction surfaces. The CRD of Frizzled receptors effectively sequesters the fatty acyl moiety of Wnt proteins from the aqueous environment, which is critical for the interaction .

What are the technical considerations for expressing and purifying functional recombinant mouse Frizzled-3 protein?

Expression and purification of functional recombinant Frizzled-3 present several technical challenges:

Expression Systems:

  • Mammalian expression systems (HEK293, CHO cells) are preferred to ensure proper folding and post-translational modifications

  • Co-expression with chaperones may improve yield and stability

Purification Considerations:

  • Similar to Wnt proteins, Frizzled receptors are membrane proteins and challenging to maintain in solution

  • Detergents are typically required during purification, which can affect protein activity

  • Alternative approach: Co-express with binding partners like the cysteine-rich domain (CRD) of a complementary protein to improve stability

Stability Enhancement:

  • Addition of stabilizing agents like glycerol (10-15%)

  • Maintaining precise pH (typically 7.4-8.0)

  • Storage at -80°C in small aliquots to minimize freeze-thaw cycles

The solubility and stability issues observed with Wnt proteins likely apply to Frizzled receptors as well, requiring careful optimization of expression and purification protocols .

How does functional redundancy between Frizzled-3 and Frizzled-6 impact experimental design and data interpretation?

The functional redundancy between Fzd3 and Fzd6 has significant implications for experimental design:

Single vs. Double Knockout Approach:

  • Single knockout of Fzd6 results in randomly oriented hair follicles, indicating only partial loss of polarity

  • Double knockout of Fzd3 and Fzd6 leads to vertically oriented hair follicles and complete loss of anterior-posterior polarity

Tissue-Specific Considerations:

  • Global knockout versus tissue-specific knockout can yield different phenotypes

  • Conditional knockouts using Cre-lox systems may be necessary to distinguish between developmental and adult functions

Compensatory Mechanisms:

  • Data from single knockout studies should be interpreted with caution due to potential compensation

  • Transcriptomic analysis should be employed to identify upregulation of compensatory pathways

Experimental Validation Table:

Experimental ApproachAdvantagesLimitationsBest Used For
Single Gene KnockoutSimpler interpretationMay miss functional redundancyInitial characterization
Double Gene KnockoutReveals redundant functionsMore complex phenotypesComprehensive functional analysis
Conditional KnockoutTemporal/spatial controlTechnical complexityDistinguishing developmental vs. adult roles
RNAi KnockdownDose-dependent effectsIncomplete suppressionRapid screening

Researchers should consider these factors when designing experiments to study Fzd3 function, as incomplete phenotypes in single knockouts may lead to misinterpretation of results .

What are the mechanisms through which Frizzled-3 regulates melanoma tumorigenesis and metastasis?

Frizzled-3 has been identified as a critical regulator of human melanoma tumorigenesis through several mechanisms:

Cell Cycle Regulation:

  • FZD3 knockdown leads to downregulation of core cell cycle proteins including cyclins D1, E2, B1, and CDKs 1, 2, and 4 in melanomas with hyperactive BRAF oncogenes

Growth and Invasion Effects:

  • Downregulation of FZD3 abrogates growth, colony-forming potential, and invasive capacity of patient-derived melanoma cells

  • Xenotransplantation studies show that tumor cells with reduced FZD3 expression have suppressed capacity for tumor formation and metastasis, particularly in melanomas carrying the BRAF(V600) mutation

Transcriptional Network Regulation:

  • FZD3 inhibits transcriptional networks controlled by CREB5, FOXD1, and ATF3, which normally suppress MAPK-mediated signaling activity

  • This suggests FZD3 may promote melanoma progression by interfering with natural tumor suppression mechanisms

Understanding these mechanisms provides potential therapeutic targets for melanoma treatment, particularly in BRAF-mutated tumors. Researchers should consider the interaction between FZD3-mediated signaling and established oncogenic pathways like MAPK when designing experiments to study melanoma progression .

How do Celsr2, Celsr3, and Frizzled-3 coordinate to regulate axon guidance, and how does this differ from their function in epithelial planar cell polarity?

The coordination between Celsr2, Celsr3, and Frizzled-3 in axon guidance involves complex molecular interactions:

Functional Redundancy:

  • Celsr2 acts redundantly with Celsr3, and their combined mutation mimics that of Fzd3 in axon guidance

  • Phenotypes generated upon inactivation of Fzd3 in different forebrain compartments are similar to those in conditional Celsr2-3 mutants, indicating they act in the same population of cells

Differential Mechanisms:

  • Unlike in epithelial PCP, the action of Celsr2-3 and Fzd3 in axon guidance is Vangl1 and Vangl2 independent

  • This represents a significant mechanistic difference from classical PCP signaling in epithelial tissues

Regional Requirements:

  • Expression of Celsr2-3 and Fzd3 in thalamocortical axons and cortical cells is required for the fine mapping of cortical areas

  • Regional inactivation using different Cre drivers (Foxg1-Cre, Emx1-Cre, Nex-Cre, Dlx5/6-Cre) reveals tissue-specific requirements for these proteins

These findings suggest that while Celsr2-3 and Fzd3 utilize components of the PCP pathway for axon guidance, they employ distinct mechanisms from those used in epithelial polarity. This has important implications for both brain development and potential regenerative approaches following neural injury .

What are the optimal assays for measuring Frizzled-3-mediated Wnt signaling activation in vitro?

Several robust assays can be employed to measure Fzd3-mediated Wnt signaling:

β-catenin Stabilization Assays:

  • Western blot analysis of cellular β-catenin levels following stimulation

  • Immunofluorescence detection of nuclear β-catenin translocation

Transcriptional Reporter Assays:

  • TOPFlash/FOPFlash luciferase reporter system measuring TCF/LEF-dependent transcription

  • qRT-PCR analysis of Wnt target genes (Axin2, Cyclin D1, c-Myc)

Functional Readouts:

  • Alkaline phosphatase (ALP) activity assays in osteoblast models

  • Proliferation assays using BrdU incorporation or Ki67 staining

  • Migration and invasion assays for cancer cell models

Surface Plasmon Resonance (SPR):

  • Direct measurement of binding affinities between purified Fzd3 CRD and Wnt ligands

  • Determination of binding kinetics and competition with other Wnt pathway components

When designing these assays, researchers should include appropriate controls to distinguish between canonical (β-catenin-dependent) and non-canonical (β-catenin-independent) Wnt signaling pathways that may be activated through Fzd3.

What strategies are most effective for studying Frizzled-3 function in vivo?

Several complementary strategies can be employed to study Fzd3 function in vivo:

Genetic Approaches:

  • Conditional knockout systems using tissue-specific Cre drivers (Foxg1-Cre, Emx1-Cre, Nex-Cre, Dlx5/6-Cre)

  • Double knockout models to address functional redundancy (e.g., Fzd3/Fzd6 double knockout)

  • CRISPR/Cas9-mediated genome editing for precise mutations

Expression Analysis:

  • Immunohistochemistry and in situ hybridization to map expression patterns

  • Reporter gene knock-ins to visualize Fzd3 expression in vivo

Functional Assays:

  • Axon tracing studies using lipophilic dyes or genetically encoded fluorescent proteins

  • Behavioral tests to assess functional consequences of Fzd3 manipulation

  • Electrophysiological recordings to evaluate neuronal connectivity

Disease Models:

  • Xenograft models using cells with manipulated Fzd3 expression

  • Analysis of metastasis and tumor formation in cancer models

Comparative Analysis Protocol:

  • Generate appropriate genetic models (single knockout, double knockout, conditional knockout)

  • Perform comprehensive phenotypic analysis at multiple developmental stages

  • Conduct molecular profiling (transcriptomics, proteomics) to identify altered pathways

  • Validate findings with rescue experiments using wild-type or mutant Fzd3

These approaches should be selected based on the specific research question and combined when appropriate to provide comprehensive insights into Fzd3 function.

How can contradictory findings about Frizzled-3 signaling in different cell types be reconciled experimentally?

Contradictory findings regarding Fzd3 signaling can be addressed through systematic experimental approaches:

Context-Dependent Signaling Analysis:

  • Side-by-side comparison of Fzd3 signaling in different cell types under identical conditions

  • Systematic variation of Wnt ligands to identify differential responses

  • Comparison of canonical vs. non-canonical pathway activation

Protein Interaction Profiling:

  • Immunoprecipitation studies to identify cell-type-specific binding partners

  • Proximity labeling approaches (BioID, APEX) to map the Fzd3 interactome in different contexts

  • Analysis of co-receptor expression and function (e.g., LRP5/6, Ror1/2)

Mechanistic Dissection:

  • Domain swapping experiments between Fzd3 and other Frizzled receptors

  • Site-directed mutagenesis of key regulatory residues

  • Pharmacological inhibition of specific downstream pathways

Experimental Resolution Framework:

Contradictory FindingExperimental ApproachExpected OutcomeInterpretation
Opposite effects on β-cateninMeasure pathway components at multiple time pointsBiphasic response or differential feedbackTemporal dynamics may explain contradictions
Cell-type specific effectsTranscriptome analysis before/after Fzd3 activationIdentification of differentially expressed modulatorsCell-type specific co-factors determine response
Conflicting in vitro vs. in vivo results3D organoid cultures with ECM componentsIntermediate phenotype between 2D culture and in vivoMicroenvironment influences signaling outcomes

For example, the unexpected finding that sFRP3 increased osteoblast differentiation rather than inhibiting it could be reconciled by examining whether sFRP3 acts through non-canonical Wnt pathways or has Wnt-independent functions in osteoblasts.

What are the best approaches for targeting Frizzled-3 therapeutically in cancer models?

Several strategic approaches can be employed to target Fzd3 therapeutically in cancer models:

Antibody-Based Approaches:

  • Development of neutralizing antibodies against the Fzd3 extracellular domain

  • Antibody-drug conjugates for targeted delivery of cytotoxic agents

  • Bispecific antibodies targeting Fzd3 and immune effector cells

Small Molecule Inhibitors:

  • Screening for compounds that disrupt Wnt-Fzd3 interactions

  • Development of inhibitors targeting the intracellular signaling domain

  • Repurposing of existing Wnt pathway inhibitors with activity against Fzd3

Genetic Approaches:

  • siRNA or shRNA delivery systems for Fzd3 knockdown

  • CRISPR/Cas9-based gene editing delivered by viral vectors

  • Antisense oligonucleotides targeting Fzd3 mRNA

Combination Strategies:

  • Co-targeting Fzd3 and BRAF in melanoma models

  • Combining Fzd3 inhibition with immune checkpoint blockade

  • Sequential treatment protocols based on tumor evolution

Preclinical Evaluation Framework:

  • Validate target expression in patient-derived xenografts

  • Establish pharmacodynamic markers of Fzd3 inhibition

  • Determine effects on tumor growth, invasion, and metastasis

  • Identify resistance mechanisms and develop countermeasures

The effectiveness of Fzd3-targeted therapies may vary across cancer types, with melanomas carrying BRAF(V600) mutations showing particular sensitivity to Fzd3 inhibition . Therapeutic approaches should consider potential redundancy with other Frizzled receptors and focus on cancer-specific signaling contexts.

How does the functional interplay between Frizzled-3 and other membrane proteins influence signaling outcomes?

Recent studies have revealed complex interactions between Fzd3 and other membrane proteins that significantly impact signaling:

The interaction between Fzd3 and Celsr family proteins (Celsr2 and Celsr3) is critical for axon guidance in the developing brain . This interaction appears to utilize mechanisms distinct from classical epithelial planar cell polarity signaling, as it functions independently of Vangl1 and Vangl2 . Understanding how these protein complexes assemble and function in specific cellular contexts represents an important frontier in Fzd3 research.

Additionally, the redundancy between Fzd3 and Fzd6 in skin development suggests potential compensatory mechanisms that may be relevant in other tissues and disease states . Research into the molecular basis of this redundancy and the factors that determine which receptor predominates in different contexts could reveal new regulatory principles in Wnt signaling.

What roles does Frizzled-3 play in stem cell regulation and tissue regeneration?

Emerging evidence points to important roles for Fzd3 in stem cell biology:

Studies have indicated that secreted frizzled-related protein 3 (sFRP3) regulates activity-dependent adult hippocampal neurogenesis , suggesting that modulation of Fzd3 signaling might influence neural stem cell behavior. Furthermore, Wnt signaling has been implicated in muscle regeneration, with evidence that it induces myogenic specification of resident CD45+ adult stem cells .

These findings point to potential applications of Fzd3 modulators in regenerative medicine, particularly for neural and muscular tissues. Further investigation into the specific mechanisms through which Fzd3 regulates stem cell maintenance, proliferation, and differentiation could yield valuable insights for therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.