Recombinant Mouse Frizzled-5 (Fzd5)

Shipped with Ice Packs
In Stock

Description

Biological Functions

FZD5 mediates both canonical (β-catenin-dependent) and non-canonical Wnt signaling :

Key Roles

  • Embryogenesis: Regulates yolk sac angiogenesis and placental vascularization .

  • Neuronal Development: Promotes synapse formation and thalamic neuron survival .

  • Immune Regulation: Orchestrates adaptive immunity via microbial stimulus responses .

Wnt Ligand Interactions

LigandActivation EfficacyPathway Involved
Wnt5AHighCanonical/Non-canonical
Wnt10BModerateCanonical
Wnt7AModerateSynaptogenesis
Wnt2BNone
Data from in vitro studies

Signaling Pathway Studies

  • Inhibits Wnt-3a-induced alkaline phosphatase production in MC3T3-E1 cells (ED₅₀: 10–60 ng/ml) .

  • Used to map Wnt/Frizzled binding interfaces via competitive assays .

Disease Models

  • Cancer: Overexpressed in tumor vasculature; potential therapeutic target .

  • Inflammation: Modulates cytokine production in macrophages .

Biochemical Assays

  • Binding Kinetics: Surface plasmon resonance (SPR) to quantify Wnt-FZD5 interactions .

  • Ubiquitination Studies: Degraded via RNF43/ZNRF3-mediated proteasomal pathways .

Regulatory and Stability Notes

  • Storage: Lyophilized form stable at -80°C for 12 months; reconstituted solution stable at 4°C for 1 week .

  • Reconstitution: 500 μg/mL in PBS .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery information.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For ease of use, we recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Fzd5; Frizzled-5; Fz-5; mFz5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-585
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
ASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFL CSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVL CMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPL YNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRY PERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFG MASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPV AGICYGVNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKL MIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLK YFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCSSRRGHKSGGAMAAGDYAEASAALTGR TGPPGPTAAYHKQVSLSHV
Uniprot No.

Target Background

Function
Frizzled-5 (FZD5) acts as a receptor for Wnt proteins. It can activate WNT2, WNT10B, and WNT5A, but not WNT2B or WNT4 (in vitro); the in vivo response may differ, as not all of these Wnt proteins are known to be coexpressed. In neurons, activation of WNT7A promotes synapse formation. FZD5 functions within the canonical Wnt/beta-catenin signaling pathway. This pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been observed for some family members, but it is unclear if it represents a distinct pathway or integrates into the canonical pathway. PKC appears to be necessary for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. FZD5 may play a role in the transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. It is also implicated in yolk sac angiogenesis and placental vascularization.
Gene References Into Functions
  1. FZD5 is a receptor for SFRP2 and mediates SFRP2-induced angiogenesis through the calcineurin/NFATc3 pathway in endothelial cells. PMID: 28840375
  2. Frizzled-5 exhibits clear upregulation at late stages in ALS neurons. Increased Frizzled-5 appears to correlate with a decrease in NeuN signal in these cells, suggesting a connection between neuronal affectation and the increased expression of this receptor. PMID: 27192435
  3. Adra2a is expressed in the mesenchyme of the mouse stomach primordium at E11.5. Fzd5 and Trpv6 are expressed in the epithelial layer of the stomach primordium after E11.5. PMID: 22266179
  4. Fzd5 and Trvp6 are expressed in the epithelial layer of the prospective pyroric and glandular stomach, respectively, and Adra2a is expressed in the mesenchymal region of the stomach primordium at the beginning of morphogenesis. PMID: 22266179
  5. Research indicates that innate immune functions of macrophages occur, at least partially, through a homeostatic Wnt5a-Fz5-NF-kappaB (p65) circuit, which is Rac1 dependent. PMID: 24706725
  6. Data suggest that Wnt5a-mediated augmentation in phagocytosis is suppressed by blocking expression of the putative Wnt5a receptor Frizzled 5. PMID: 23012420
  7. Studies suggest a dose-dependent regulation of signaling by Fz5 and Fz8 in optic fissure/disc formation and progenitor expansion PMID: 22228100
  8. Interprets Wnt signals during embryonic mesoderm and neural induction. PMID: 17576136
  9. Frizzled-5 plays a role in embryonic neural development in mice PMID: 18489003
  10. Defects in Wnt-Frizzled signaling could contribute to neuronal loss in degenerative CNS diseases. PMID: 18509025
  11. Selective loss of Fzd5 in the retina results in PHPV and retinal defects through an apparently cell-nonautonomous effect, highlighting a potential requirement for retina-derived signals in regulating the development of the VHV. PMID: 18791178
  12. These findings demonstrate a central role for frizzled signaling in mammalian eye development and are likely relevant to the etiology of congenital human ocular anomalies. PMID: 18832390

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cell junction, synapse. Perikaryon. Cell projection, dendrite. Cell projection, axon.
Tissue Specificity
Detected in hippocampus (at protein level). Expressed in eye, kidney, lung, chondrocytes, epithelial cells of the small intestine and gobelet cells of the colon.

Q&A

What is the structural composition of Mouse Frizzled-5 protein?

Structurally, Mouse Frizzled-5 is a G protein-coupled receptor consisting of several key domains: a divergent signal peptide, a highly conserved extracellular cysteine-rich domain (CRD), a variable-length linker region, a seven-pass transmembrane domain, and a variable-length C-terminal tail . The mature mouse Frizzled-5 protein contains a 212 amino acid extracellular domain (ECD), a 283 amino acid seven-transmembrane region, and a 64 amino acid cytoplasmic domain with a PDZ binding motif . This structure is characteristic of the Frizzled family, facilitating specific interactions with Wnt ligands and downstream signaling components.

How conserved is Frizzled-5 across species?

Within the N-terminal extracellular domain (ECD), human Frizzled-5 shares 95% amino acid sequence identity with mouse and rat Frizzled-5, indicating high evolutionary conservation . This conservation is especially pronounced in the cysteine-rich region (CRD) that binds Wnts and is highly conserved among all Frizzled proteins . The high sequence homology suggests functional conservation and allows for meaningful translation of research findings between species, particularly in developmental and pathological contexts.

Which Wnt ligands interact with Mouse Frizzled-5?

Mouse Frizzled-5 functions as a receptor for multiple Wnt ligands, including Wnt-5a, Wnt-9b, Wnt-10b, Wnt-2b, and Wnt-7a . The specificity of these interactions is determined primarily by the cysteine-rich domain (CRD) in the extracellular portion of the receptor. In functional assays, recombinant Mouse Frizzled-5 has been shown to inhibit Wnt-3a induced alkaline phosphatase production in MC3T3-E1 mouse preosteoblast cells, with an ED50 of 0.01-0.06 μg/ml . This diverse ligand-binding profile contributes to the broad functional roles of Frizzled-5 in different tissues and developmental contexts.

How does Frizzled-5 participate in canonical and non-canonical Wnt signaling?

Frizzled-5 can activate both canonical Wnt/beta-catenin signaling and non-canonical pathways including Wnt/Ca2+ pathways and planar cell polarity . In canonical signaling, Wnt engagement of Frizzled, with low-density lipoprotein receptor-related proteins LRP-5 or LRP-6 acting as co-receptors, stabilizes beta-catenin and promotes gene transcription essential for development and tissue maintenance . Frizzleds can also signal through non-canonical pathways independently of LRPs . The specific pathway activated depends on the cellular context, the specific Wnt ligand, and the presence of co-receptors and intracellular signaling components.

What role does Frizzled-5 play in the Wnt5A/JNK signaling pathway?

Frizzled-5 is believed to be the primary receptor for the Wnt5A ligand and plays a crucial role in activating the JNK (c-Jun N-terminal kinase) signaling pathway . In pathological conditions such as heart failure, inhibition of the Wnt5A/JNK signaling pathway through interventions like SFRP5 (Secreted Frizzled-Related Protein 5) administration has shown protective effects . Research demonstrates that when SFRP5 recombinant protein is administered to mice with heart failure, it increases SFRP5 protein expression while decreasing Wnt5a and JNK protein expression levels . This mechanism appears to reduce oxidative stress and inflammation, suggesting potential therapeutic applications.

What intracellular proteins interact with Frizzled-5 for signal transduction?

The cytoplasmic domain of Frizzled-5 contains a KTXXXW motif that mediates interaction with Dishevelled proteins, which are critical intracellular signal-transduction components . Additionally, PDZ-domain proteins like PSD-95 can interact with mouse Frizzled proteins including Fz1, Fz2, Fz4, and Fz7 . For Frizzled-3, a protein called Kermit interacts directly with the cytoplasmic domain and is recruited to the cell surface specifically by this receptor . While specific Kermit-like molecules for Frizzled-5 have not been fully characterized, these interaction patterns suggest complex signaling networks downstream of Frizzled receptors.

What is the expression pattern of Frizzled-5 in embryonic and adult tissues?

Frizzled-5 exhibits a diverse expression pattern across development and adulthood. In embryonic tissues, it is expressed in the telencephalon, pituitary, thalamus, hypothalamus, eye, liver, spleen, lung, and kidney . In adult tissues, Frizzled-5 expression is maintained in the retina, colon, and pancreatic islets . It is also expressed in some cancer cell lines, human embryonic stem cells, and specific immune cell populations including monocytes and lymphocytes . This broad expression pattern correlates with the diverse functions of Frizzled-5 in tissue development, maintenance, and response to pathological conditions.

How does Frizzled-5 contribute to vascular development?

Frizzled-5 plays a critical role in vascular development and maintenance. It contributes to the maintenance of yolk sac and placental vasculature during embryonic development . Additionally, it is involved in the regression of vitreous vasculature during eye development . Mutations in human FZD4, a related Frizzled family member, are associated with familial exudative vitreoretinopathy (FEVR), an inherited form of retinal degeneration with progressive hearing loss . These findings highlight the importance of Frizzled receptors in vascular development and homeostasis.

What roles does Frizzled-5 play in neuronal development?

Frizzled-5 is essential for multiple aspects of neuronal development and function. It mediates the synaptogenic effect of Wnt-7a, contributes to the development of neuronal polarity, and is required for neuronal survival in the thalamus . Loss of Frizzled-5 function can lead to neuronal defects, particularly in regions where it is highly expressed during development, such as the telencephalon, thalamus, and hypothalamus . These functions highlight the importance of Wnt/Frizzled signaling in establishing proper neural connectivity and maintaining neuronal health.

How should researchers reconstitute and handle recombinant Mouse Frizzled-5 proteins?

Recombinant Mouse Frizzled-5 protein is typically provided in lyophilized form and should be reconstituted according to manufacturer specifications. For example, R&D Systems' Recombinant Mouse Frizzled-5 Fc Chimera Protein should be reconstituted at 500 μg/mL in PBS . After reconstitution, it's recommended to store the protein at the temperature recommended by the manufacturer (often -20°C) and avoid repeated freeze-thaw cycles to maintain protein stability and activity . For carrier-free versions without BSA, special handling considerations may apply when using the protein in applications where BSA could interfere with experimental outcomes.

What functional assays can be used to study Frizzled-5 activity?

Several functional assays can be employed to study Frizzled-5 activity:

Assay TypeDescriptionTypical ReadoutReference
Alkaline Phosphatase ProductionMeasures inhibition of Wnt-3a induced alkaline phosphatase in MC3T3-E1 cellsED50: 0.01-0.06 μg/ml
Wnt Signaling InhibitionAssesses recombinant Frizzled-5's ability to sequester Wnt ligandsVaries by cell type
Binding AssaysEvaluates direct interaction with labeled Wnt ligandsAffinity constants
Calcium MobilizationMeasures Wnt/Ca2+ pathway activationFluorescence response

These assays provide complementary information about Frizzled-5 function in different contexts and can be selected based on the specific research question being addressed.

How can researchers validate the purity and activity of recombinant Frizzled-5 protein?

Validation of recombinant Frizzled-5 protein should include both purity and functional assessments. Purity can be assessed using SDS-PAGE, with high-quality preparations typically showing >95% purity . Endotoxin levels should be measured (e.g., LAL test) and should be less than 0.01EU/μg purified protein for reliable experimental outcomes . Functional validation can include the alkaline phosphatase inhibition assay in MC3T3-E1 cells, with expected ED50 values between 0.01-0.06 μg/ml when inhibiting Wnt-3a (5 ng/mL) induced responses . Additionally, binding assays with known Wnt ligands can confirm proper folding and biological activity of the recombinant protein.

How is Frizzled-5 signaling implicated in heart failure models?

In heart failure models, dysregulation of Wnt5A/JNK signaling (which involves Frizzled-5 as a receptor) contributes to pathological processes. Studies using isoproterenol-induced heart failure in mice have shown that SFRP5 (Secreted Frizzled-Related Protein 5) recombinant protein has protective effects . After intraperitoneal injection of SFRP5 recombinant protein (0.02 mg/kg/24h) in mice with heart failure, researchers observed reduced inflammatory responses and improved left ventricular systolic and diastolic function . The mechanism appears to involve inhibition of the Wnt5A/JNK signaling pathway, reduction of oxidative stress, and attenuation of inflammation .

What is the role of Frizzled-5 in inflammatory responses?

Frizzled-5 plays a significant role in inflammatory responses, particularly in macrophages and monocytes. Research has shown that Frizzled-5 signaling in these cells induces the production of inflammatory cytokines . Recent studies of WNT5A/Frizzled-5 signaling have revealed an unexpected and novel role in orchestrating adaptive immunity in response to microbial stimulation . This suggests that targeting Frizzled-5 signaling might offer therapeutic opportunities in inflammatory conditions. The interaction between SFRP5 and Frizzled-5 signaling also influences inflammatory processes, as demonstrated in heart failure models where SFRP5 administration reduced inflammatory cell infiltration in myocardial tissue .

How do Secreted Frizzled-Related Proteins (SFRPs) modulate Frizzled-5 signaling?

Secreted Frizzled-Related Proteins (SFRPs), particularly SFRP5, modulate Frizzled-5 signaling by competing with Frizzled receptors for Wnt ligand binding. SFRP5 contains a cysteine-rich domain similar to the extracellular domain of Frizzled receptors, allowing it to sequester Wnt ligands and prevent their interaction with Frizzled-5 . In experimental models, administration of SFRP5 recombinant protein increases SFRP5 levels while decreasing Wnt5a and JNK protein expression . This modulation appears to have protective effects in pathological conditions such as heart failure, where SFRP5 treatment improves myocardial tissue structure and function by inhibiting the Wnt5A/JNK signaling pathway and reducing oxidative stress .

What are current controversies regarding G protein coupling in Frizzled-5 signaling?

A significant controversy in Frizzled research concerns whether these receptors directly couple to G proteins for signal transduction. Despite their classification as G protein-coupled receptors (GPCRs), the exact mechanism of G protein coupling remains contested. As noted in the literature, "the exciting possibility that Frizzleds couple directly to G proteins is still a controversial area, perhaps in part because of the lack of genetic data to support the idea of this interaction" . This controversy has implications for understanding the precise mechanisms of both canonical and non-canonical Wnt signaling through Frizzled-5 and may influence the development of targeted therapeutics or experimental approaches.

What methodological challenges exist in studying Frizzled-5 signaling specificity?

Studying Frizzled-5 signaling specificity presents several methodological challenges:

  • Redundancy among Frizzled receptors and Wnt ligands complicates interpretation of knockout studies

  • Context-dependent signaling outcomes vary based on cell type and developmental stage

  • Distinguishing between canonical and non-canonical pathway activation requires specialized assays

  • Co-receptor involvement (e.g., LRP5/6) introduces additional variables

Researchers must employ multiple complementary approaches including genetic models, biochemical assays, and cell-based systems to fully characterize Frizzled-5 signaling specificity in different contexts.

How might post-translational modifications affect Frizzled-5 function?

Post-translational modifications likely play important roles in regulating Frizzled-5 function, though this area remains incompletely characterized. Glycosylation of the extracellular domain may affect ligand binding and receptor stability. Phosphorylation of intracellular domains could modulate interactions with downstream signaling partners including Dishevelled proteins and other PDZ-domain containing proteins . Additionally, ubiquitination may regulate receptor trafficking and turnover. Understanding these modifications presents both experimental challenges and opportunities for therapeutic intervention by targeting specific modified forms of the receptor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.