Recombinant Mouse Frizzled-7 (Fzd7)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Mouse Fzd7 is a bioengineered version of the endogenous Frizzled-7 receptor, produced via heterologous expression systems. Key characteristics include:

FeatureDetailsSource
Expression SystemsE. coli, yeast, baculovirus, or mammalian cells (e.g., Sf9 insect cells)
Molecular Weight~63–65 kDa (full-length)
Purity≥85% (SDS-PAGE verified)
Structural DomainsCysteine-rich domain (CRD), seven transmembrane helices, cytoplasmic tail

The CRD (aa 44–169) binds Wnt ligands and co-receptors like LRP5/6, while the transmembrane domains enable signal transduction .

Research Applications

Recombinant Fzd7 is used in diverse functional studies:

Stem Cell and Developmental Biology

  • Embryonic Stem Cell Maintenance: Fzd7 knockout in human ESCs disrupts self-renewal, while recombinant Fzd7 restores Wnt/β-catenin signaling .

  • Mesendoderm Differentiation: Engineered F7L6 (Fzd7/LRP6-binding protein) induces primitive streak-like transcription in hPSCs, bypassing CRD dependency .

Cancer Research

Cancer TypeFzd7 RoleTherapeutic StrategySource
ColorectalPromotes proliferation, invasion, and metastasisCRISPR knockdown or Fzd7-targeted antibodies
GastricEssential for epithelial homeostasis; loss triggers rapid repopulationTargeted gene therapy (pFZD7-Stx1)
Embryonal CarcinomaSustains pluripotency in EC cellssiRNA-mediated knockdown reduces tumor growth

Therapeutic Potential

Fzd7 is a target in cancer due to its overexpression in tumors and role in β-catenin-independent signaling:

  • Gene Therapy: pFZD7-driven expression of Shiga-like toxin I (Stx1) selectively kills Fzd7-positive cancer cells .

  • Antibody-Based Therapies: Neutralizing antibodies (e.g., AF198) inhibit Wnt signaling in preclinical models .

Challenges and Future Directions

  • Receptor Selectivity: Fzd7’s promiscuity with other Wnts and receptors complicates drug design. Engineered ligands like F7L6 offer specificity .

  • Cancer Dependency: Fzd7’s role in stem cell niches requires precise targeting to avoid off-tumor effects .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing it.
Synonyms
Fzd7; Frizzled-7; Fz-7; mFz7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-572
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKV QCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFP VHGAGEICVGQNTSDGSGGAGGSPTAYPTAPYLPDPPFTAMSPSDGRGRLSFPFSCPRQL KVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLSCASTLFTVLT YLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKE GCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTI TILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIM KHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVP CPPRHFSPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
Uniprot No.

Target Background

Function
Frizzled-7 (Fzd7) is a receptor for Wnt proteins. Most frizzled receptors are linked to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been observed for some family members, but it remains unclear if it represents a distinct pathway or if it can be integrated into the canonical pathway, as PKC appears to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Activation by WNT8 induces expression of beta-catenin target genes. Following ligand activation, Fzd7 binds to CCDC88C/DAPLE, which displaces DVL1 from FZD7 and leads to inhibition of canonical Wnt signaling, activation of G-proteins by CCDC88C, and triggering of non-canonical Wnt responses. Fzd7 may be involved in the transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.
Gene References Into Functions
  1. These data provide functional evidence of a crucial role for Wnt signaling, via the Fzd7 receptor, during homeostasis of the gastric epithelium. PMID: 28600348
  2. FZD7 transmits non-canonical Wnt signaling by interacting with Wnt5A in the regulation of extracellular matrix expression. PMID: 28736081
  3. Fzd7 is enriched in Lgr5(+) stem cells and binds Wnt3 and Wnt2b. PMID: 25892522
  4. The Wnt receptor, frizzled-7, is a downstream target of miR-184, and delivery of miR-184 mimic inhibits Wnt signaling in the OIR retina. PMID: 25796186
  5. Fzd7 is a new partner of the adherens junctional complex and represents a novel molecular switch for the control of vascular permeability via activation of the Wnt-canonical pathway. PMID: 24866384
  6. Genetic interactions between Fz2 and Fz7 and five canonical and/or non-canonical signaling molecules were observed: Dvl3, Wnt3a, Wnt11, Vangl2, and Wnt5a. PMID: 23095888
  7. Data indicate that the Fzd7 receptor complex was associated with Galpha(s) and PI(3)K, and these components were required for Wnt7a to activate the Akt/mTOR growth pathway in myotubes. PMID: 22179044

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of mouse Frizzled-7?

Mouse Frizzled-7 (accession number Q61090) functions as a receptor for Wnt proteins. It belongs to a distinct subfamily within the Frizzled family of Wnt receptors, clustered with Fz1 and Fz2 . Most frizzled receptors, including Fzd7, are coupled to the β-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of β-catenin, and activation of Wnt target genes . Following ligand activation, Fzd7 binds to CCDC88C/DAPLE, which displaces DVL1 and leads to inhibition of canonical Wnt signaling, activation of G-proteins, and triggering of non-canonical Wnt responses .

How does Frizzled-7 compare to other Frizzled family members in signaling capability?

Frizzled-7 forms a distinct subfamily with Frizzled-1 and Frizzled-2 based on sequence homology and functional redundancy . In vitro experiments indicate that both Fz2 and Fz7 are competent to signal via the canonical pathway . Unlike some other Frizzled receptors that may predominantly signal through either canonical or non-canonical pathways, Fzd7 appears versatile, participating in both the β-catenin canonical pathway and a second signaling pathway involving PKC and calcium fluxes . This dual signaling capability makes Fzd7 particularly interesting for studying pathway crosstalk and context-dependent signaling outcomes.

What is the embryonic expression pattern of Frizzled-7?

X-Gal staining of Fz7^lacZ/lacZ embryos at E8.5 and E9.5 shows widespread expression of the lacZ reporter, including throughout the developing nervous system and somites . This pattern closely resembles the embryonic expression patterns observed for Fz1 and Fz2 alleles, suggesting potential functional redundancy during development . The expression can be detected in embryonic mouse gastrointestinal tract (11 d.p.c.) using immunohistochemistry techniques with appropriate antibodies .

What are the optimal methods for detecting endogenous Frizzled-7 expression in tissues?

For detecting endogenous Frizzled-7 in tissues, multiple validated approaches exist:

  • Western Blot (WB): Successful detection has been reported in mouse skeletal muscle, heart, and kidney tissues using a dilution range of 1:500-1:2000 . For optimal results, non-reducing conditions may preserve the native structure of Frizzled-7, as demonstrated in some studies .

  • Immunohistochemistry (IHC): Effective detection in tissues such as human small intestine and mouse embryonic gastrointestinal tract using a dilution of 1:400-1:1600 . Antigen retrieval with TE buffer pH 9.0 is recommended, though citrate buffer pH 6.0 may also be effective .

  • Immunoprecipitation (IP): Can be performed using 0.5-4.0 μg of antibody for 1.0-3.0 mg of total protein lysate, with successful detection reported in mouse skeletal muscle tissue .

How can recombinant Frizzled-7 be effectively used in binding assays?

Immobilized Human Frizzled-7 with His Tag at 5 μg/mL (100 μL/well) can bind Wnt surrogate proteins with a linear range of 1-16 ng/mL . When using biotinylated binding partners such as Glypican 3 loaded on SA Biosensor, Frizzled-7 binding affinity can be determined using bio-layer interferometry (BLI) assays, with reported affinity constants around 1.18 μM . These quantitative binding assays provide important insights into receptor-ligand interactions that underpin Wnt signaling pathways.

How does knockdown of Frizzled-7 affect cell proliferation in experimental models?

Knockdown studies have demonstrated that siRNA targeting FZD7 leads to significant reduction in growth of embryonal carcinoma (EC) cells . In NT2/D1 cells, FZD7 knockdown resulted in decreased cell numbers after 4 days compared to controls, with statistical significance (p < 0.005) . Similar effects were observed in cisplatin-resistant NT2/D1-R1 cells, suggesting that Frizzled-7 signaling may be important for maintaining proliferation in both sensitive and drug-resistant cellular contexts . These findings highlight the potential therapeutic relevance of targeting Frizzled-7 in certain cancer types.

What approaches can differentiate between canonical and non-canonical signaling outcomes of Frizzled-7 activation?

Distinguishing between canonical and non-canonical signaling downstream of Frizzled-7 requires multi-faceted experimental approaches:

  • Transcriptional reporters: TOPFlash/FOPFlash luciferase assays can measure β-catenin-dependent transcriptional activation as a readout of canonical signaling.

  • Protein localization: Immunofluorescence detection of β-catenin nuclear translocation indicates canonical pathway activation.

  • Calcium imaging: Since Frizzled-7 can activate a second signaling pathway involving calcium fluxes, calcium indicators can monitor non-canonical pathway activation .

  • Co-immunoprecipitation: Detecting CCDC88C/DAPLE binding to Frizzled-7, which displaces DVL1 and inhibits canonical signaling while promoting non-canonical responses .

  • G-protein activation assays: Measuring GTPase activity can indicate activation of non-canonical pathways, as Frizzled-7 interactions with G-proteins have been implicated in both signaling routes .

How can researchers address functional redundancy between Frizzled-7 and related receptors?

Addressing functional redundancy between Frizzled-7 and related receptors requires strategic experimental approaches:

  • Combinatorial knockouts: Generate and analyze double knockout models (e.g., Fz2^-/-;Fz7^-/-) to reveal phenotypes masked by redundancy .

  • Conditional tissue-specific knockouts: Target specific tissues or developmental timepoints to bypass early lethality that may result from complete knockout of redundant receptors.

  • Domain swapping experiments: Create chimeric receptors to identify which regions confer functional specificity versus redundancy.

  • Ligand specificity analysis: Systematically test all pairwise combinations of Frizzleds and Wnts, as has been done for canonical signaling, to map receptor-ligand selectivity .

  • Expression correlation analysis: Examine co-expression patterns of Frizzled family members across tissues to identify potential compensatory mechanisms.

What molecular mechanisms underlie the genetic interactions between Frizzled-7 and other developmental genes?

Genetic interactions between Fz7 and other developmental genes reflect complex signaling networks:

  • Interaction with Vangl2: As a component of the planar cell polarity pathway, Vangl2 interacts with Frizzled signaling in processes such as convergent extension .

  • Interaction with Dvl3: Dishevelled proteins act downstream of Frizzled receptors in both canonical and non-canonical pathways, mediating signal transduction .

  • Interaction with Wnt ligands: Different Wnt ligands can preferentially activate canonical versus non-canonical pathways through the same Frizzled receptor, depending on co-receptor availability and cellular context .

These interactions highlight how Frizzled-7 functions within integrated signaling networks rather than in isolation, with significant implications for developmental processes and disease mechanisms when these networks are perturbed.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.