Recombinant Mouse Frizzled-8 (Fzd8)

Shipped with Ice Packs
In Stock

Description

Overview of the Frizzled Family

The Frizzled family comprises at least ten seven-transmembrane glycoproteins that function as receptors for Wnt ligands. These receptors are pivotal in mediating canonical and non-canonical Wnt signaling pathways. Canonical pathways involve β-catenin stabilization and gene transcription, while non-canonical pathways regulate cytoskeletal dynamics and cell polarity . Frizzled-8 (Fzd8) is a prominent member of this family, sharing structural similarities with other Frizzled proteins but also exhibiting unique functional attributes.

Specificity of Mouse Frizzled-8

Mouse Frizzled-8 is encoded by the Fzd8 gene and consists of 685 amino acids. It includes a signal peptide, an extracellular cysteine-rich domain (CRD), a seven-transmembrane domain (7TM), and a cytoplasmic PDZ-binding motif. The CRD plays a key role in binding Wnt ligands, facilitating signal transduction . Recombinant versions of this protein are widely used in research to study Wnt signaling mechanisms and their implications in development and disease.

Production and Purity

Recombinant Mouse Frizzled-8 is typically produced using expression systems such as Escherichia coli or mammalian cells. The protein is purified to high standards, often exceeding 85% purity as assessed by SDS-PAGE analysis . Lyophilized formulations are common, ensuring stability during storage and transport.

Table 1: Biochemical Properties of Recombinant Mouse Frizzled-8

PropertyDescription
Molecular Weight~75 kDa (including tags)
Purity>85% (SDS-PAGE)
Expression SystemE. coli or mammalian cells
Storage Conditions-20°C/-80°C
Reconstitution BufferSterile PBS or deionized water
StabilityLyophilized: 12 months; Liquid: 6 months

Canonical Wnt Signaling Pathway

In the canonical pathway, Fzd8 interacts with Wnt ligands and co-receptors such as LRP5/6 to stabilize β-catenin. This stabilization prevents β-catenin degradation, allowing it to translocate into the nucleus where it activates target gene transcription . This pathway is crucial for processes like cell proliferation, differentiation, and tissue regeneration.

Non-Canonical Pathways

Fzd8 also participates in non-canonical pathways that are independent of β-catenin. These pathways regulate cytoskeletal organization, cell migration, and planar cell polarity. For example, Fzd8 mediates epithelial-to-mesenchymal transition (EMT) by integrating Wnt11 and TGF-β signals .

Role in Developmental Biology

Mouse models have demonstrated that Fzd8 is essential for embryonic development. Knockout studies reveal its involvement in kidney morphogenesis and ureteric bud growth . These findings underscore its role in organogenesis and tissue patterning.

Drug Development

Fzd8 has emerged as a potential therapeutic target in diseases such as osteoporosis (OP) and cancer:

  • Osteoporosis: Knockout studies indicate that Fzd8 modulates osteoblast and osteoclast activity, influencing bone remodeling .

  • Cancer: Fzd8 promotes tumor proliferation and metastasis via the Wnt/β-catenin pathway. Targeting Fzd8 suppresses migration and invasion in breast cancer and non-small cell lung cancer cells .

Table 2: Therapeutic Implications of Fzd8

DiseaseMechanismPotential Therapeutics
OsteoporosisModulates bone remodeling via Wnt signalingFzd8 inhibitors or agonists
Breast CancerPromotes metastasis through β-catenin pathwayAnti-Fzd8 antibodies
Non-Small Cell Lung CancerEnhances invasion via EMTSmall molecule inhibitors targeting Fzd8

Functional Assays

Functional assays demonstrate that recombinant Fzd8 binds biotinylated mouse Wnt ligands with high affinity (Kd<1 nMK_d < 1 \text{ nM}) . This interaction is critical for validating its role in signal transduction.

Gene Knockout Studies

CRISPR/Cas9-mediated knockout models reveal significant alterations in bone-related gene expression upon Fzd8 deletion:

  • Upregulation of Col1a1, Col3a1, and Ibsp genes.

  • Downregulation of osteoblast markers correlates with increased osteoclast activity .

Table 3: Differential Gene Expression in Fzd8 Knockout Mice

GeneExpression ChangeBiological Implication
Col1a1UpregulatedEnhanced collagen production
IbspUpregulatedIncreased bone resorption
S100a8DownregulatedImpaired inflammatory response

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference for your own protocols.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Fzd8; Frizzled-8; Fz-8; mFz8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-685
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
ASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFF LCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTL CMDYNRTDLTTAAPSPPRRLPPPPPPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDAAAA PPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFS QDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVR LVAGHEKVACSGGAPGAGGAGGAGGAAAAGAGAAGAGASSPGARGEYEELGAVEQHVRYE TTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVP SVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFR IRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPC LRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGAAV GAGAGGSGPGGSGPGPGGGGGHGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
Uniprot No.

Target Background

Function

Frizzled-8 (Fzd8) is a receptor for Wnt proteins, functioning as a component of the Wnt-Fzd-LRP5-LRP6 complex. This complex initiates β-catenin signaling by aggregating receptor-ligand complexes into ribosome-sized signalosomes. The canonical β-catenin pathway activates disheveled proteins, inhibits GSK-3 kinase, promotes nuclear β-catenin accumulation, and ultimately activates Wnt target genes. Another signaling pathway involving PKC and calcium fluxes has been observed for some Fzd family members; however, its relationship to the canonical pathway remains unclear, though PKC appears necessary for Wnt-mediated GSK-3 kinase inactivation. Both pathways appear to involve G-protein interactions. Fzd8 may also participate in transducing and transmitting polarity information during tissue morphogenesis and/or in differentiated tissues. Furthermore, it acts as a coreceptor with RYK for Wnt proteins, such as Wnt1.

Gene References Into Functions
  1. Varying soluble Frizzled8-cysteine-rich-domain protein concentrations modulated Wnt3a signaling biphasically. PMID: 24885675
  2. Flamingo (Fmi) and Frizzled 8 (Fz8), components of noncanonical Wnt signaling, are expressed in and functionally maintain quiescent long-term hematopoietic stem cells. PMID: 22817897
  3. The structure of Xenopus Wnt8 (XWnt8) complexed with the mouse Fzd8 cysteine-rich domain was determined at 3.25 Å resolution. PMID: 22653731
  4. Molecular modeling of the complex between xWNT8 protein and the CRD domain of mFZD8 was performed. PMID: 17506343
  5. Insulin-like growth factor-binding protein-4 interacts with Wnt receptor Frizzled 8 (Frz8) and co-receptor LRP6, inhibiting Wnt3A binding to Frz8 and LRP6. PMID: 18528331
Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein. Golgi apparatus. Cell membrane; Multi-pass membrane protein. Note=Colocalizes with GOPC at the Golgi apparatus.
Tissue Specificity
Expressed in chondrocytes.

Q&A

What is Frizzled-8 (Fzd8) and what is its biological significance in mouse models?

Frizzled-8 (Fzd8) is a transmembrane protein receptor that plays a crucial role in the Wnt signaling pathway, which regulates various developmental and homeostatic processes. In mouse models, Fzd8 has been identified as a critical mediator of bone development and homeostasis. Recent research using Fzd8-knockout mouse models generated through CRISPR/Cas9 genome editing has demonstrated that Fzd8 significantly influences bone mineral density, bone volume, and the balance between osteoblasts and osteoclasts . The inactivation of Fzd8 results in an osteoporosis-like phenotype, characterized by decreased bone mass and compromised bone structure, highlighting its importance in maintaining skeletal integrity .

How does Fzd8 contribute to bone development and homeostasis?

Fzd8 contributes to bone development and homeostasis through its integral role in the Wnt signaling pathway, which is essential for regulating bone formation and remodeling. Research using Fzd8-knockout mouse models has revealed several key mechanisms:

  • Fzd8 regulates bone mineral density (BMD) of both cortical and trabecular bones, with knockout mice showing significantly reduced BMD .

  • Fzd8 influences bone volume and structure, with knockout mice exhibiting decreased total volume (TV) and bone volume (BV) of cortical bone .

  • Fzd8 maintains the balance between bone-forming osteoblasts and bone-resorbing osteoclasts. Homozygous Fzd8-knockout mice show a significant increase in osteoclast numbers and a reduction in osteoblasts .

  • Fzd8 regulates the expression of key genes involved in bone remodeling, including Fzd10 and Lta, as well as proteins such as Itgb3 and RANK .

These findings collectively demonstrate that Fzd8 plays a critical role in maintaining bone homeostasis by coordinating the balance between bone formation and resorption processes.

What evidence supports Fzd8 as a potential therapeutic target for osteoporosis?

Several lines of evidence from recent research support Fzd8 as a promising therapeutic target for osteoporosis:

  • Fzd8-knockout mice display phenotypic characteristics resembling osteoporosis, including decreased bone mineral density, reduced bone volume, and compromised bone structure . This suggests that modulating Fzd8 activity could potentially influence bone metabolism.

  • Significant alterations in bone-related biomarkers are observed in Fzd8-knockout mice. These include decreased levels of N-terminal propeptide of type I procollagen (P1NP), a marker of bone formation, and increased levels of S-CTX, a marker of bone resorption .

  • Molecular analysis reveals that Fzd8 knockout leads to significant changes in the expression of genes and proteins critical for bone remodeling:

    • Down-regulation of Fzd10 expression

    • Up-regulation of lipoteichoic acid (Lta) expression

    • Increased expression of Itgb3 (integrin beta-3) and RANK proteins

  • Pathway and gene set enrichment analyses of differentially expressed genes (DEGs) in Fzd8-knockout mice indicate associations with osteoporosis-related molecular processes .

These findings suggest that therapeutic interventions targeting Fzd8 could potentially modulate bone metabolism pathways, offering a novel approach for osteoporosis treatment and drug development.

What genetic and molecular changes occur following Fzd8 inactivation that correlate with osteoporosis?

Fzd8 inactivation induces multiple genetic and molecular changes that correlate with osteoporosis development:

  • Differential gene expression:

    • Significant down-regulation of Fzd10, another member of the frizzled receptor family involved in Wnt signaling .

    • Marked up-regulation of lipoteichoic acid (Lta), which may contribute to inflammatory processes affecting bone metabolism .

    • Alterations in numerous genes associated with the canonical Wnt signaling pathway, which is crucial for bone formation.

  • Protein expression changes:

    • Increased expression of Itgb3 (integrin beta-3) protein in homozygous Fzd8-knockout mice, which enhances osteoclast function and bone resorption .

    • Elevated expression of RANK (receptor activator of nuclear factor κB) protein, essential for osteoclast differentiation and activation .

    • Higher expression of Wnt3a protein, potentially as a compensatory response to Fzd8 deficiency .

  • Genetic polymorphisms and variations:

    • Differentially expressed genes (DEGs) related to exons SNP before transcription in heterozygous and homozygous mice .

    • DEGs related to exons SNP after transcription, some of which are potentially associated with osteoporosis .

These molecular alterations collectively contribute to an imbalance in bone remodeling, with increased bone resorption and decreased bone formation, characteristic features of osteoporosis.

How do bone phenotypic parameters differ between wild-type and Fzd8-knockout mice?

Comprehensive analysis of bone phenotypic parameters reveals significant differences between wild-type (WT) and homozygous (HO) Fzd8-knockout mice, as demonstrated in recent micro-CT and biochemical studies:

These comprehensive phenotypic differences clearly demonstrate that Fzd8 deficiency leads to compromised bone structure and quality, closely resembling the pathophysiology of osteoporosis.

How does Fzd8 knockout affect the cellular composition and dynamics of bone tissue?

Fzd8 knockout induces significant changes in bone tissue cellular composition and dynamics, revealed through histological and immunohistochemical analyses:

  • Osteoclast population changes:

    • Significantly increased number of osteoclasts in homozygous Fzd8-knockout mice compared to wild-type mice

    • Enhanced osteoclast activity, evidenced by elevated bone resorption markers (S-CTX)

    • Histological evidence of increased osteoclast presence at bone surfaces

  • Osteoblast population changes:

    • Markedly reduced number of osteoblasts in homozygous Fzd8-knockout mice compared to wild-type mice

    • Decreased osteoblast activity, indicated by lower bone formation markers (P1NP)

    • Impaired bone-forming capacity observed in histological sections

  • Protein expression alterations that influence cell dynamics:

    • Increased expression of Itgb3 (integrin beta-3) protein in HO mice, which enhances osteoclast adhesion and function

    • Elevated RANK expression in HO mice, promoting osteoclast differentiation and activation

    • Higher Wnt3a protein expression in HO mice, potentially as a compensatory mechanism in response to Fzd8 deficiency

These cellular changes collectively create an imbalance in bone remodeling with bone resorption exceeding bone formation, leading to net bone loss—a hallmark feature of osteoporosis.

What are the relationships between Fzd8 and other molecules (Fzd10, Lta, Itgb3, RANK) in the regulation of bone metabolism?

The complex interrelationships between Fzd8 and other molecular players in bone metabolism provide insights into the mechanisms underlying osteoporosis development:

  • Fzd8 and Fzd10:

    • Fzd10 expression is significantly down-regulated in Fzd8-knockout mice

    • Both are frizzled receptors involved in the Wnt signaling pathway critical for bone formation

    • The downregulation of Fzd10 in Fzd8-knockout mice suggests a compensatory mechanism or interdependence between these receptors

    • Studies indicate that Fzd10 is a predicted target gene of differentially expressed miRNAs in osteoporosis, with its expression typically down-regulated in osteoporotic conditions

  • Fzd8 and Lta (lipoteichoic acid):

    • Lta expression is significantly up-regulated in Fzd8-knockout mice

    • This up-regulation suggests that Fzd8 normally suppresses Lta expression

    • Lta is involved in inflammatory processes that can influence bone metabolism

    • Increased Lta expression may contribute to enhanced osteoclastogenesis and bone resorption

  • Fzd8 and Itgb3 (integrin beta-3):

    • Immunohistochemical analysis shows significantly higher Itgb3 protein expression in Fzd8-knockout mice

    • Itgb3 plays a critical role in osteoclast adhesion, migration, and resorptive function

    • Increased Itgb3 expression correlates with enhanced osteoclast activity and bone resorption in Fzd8-knockout mice

  • Fzd8 and RANK:

    • RANK protein expression is significantly elevated in Fzd8-knockout mice

    • RANK is essential for osteoclast differentiation and activation

    • Increased RANK expression explains the higher osteoclast numbers and enhanced bone resorption observed in Fzd8-knockout mice

These molecular relationships demonstrate that Fzd8 functions as a central regulator in bone metabolism, coordinating multiple pathways that maintain the balance between bone formation and resorption.

What molecular pathways are disrupted by Fzd8 deficiency that contribute to osteoporosis-like phenotypes?

Fzd8 deficiency disrupts several interconnected molecular pathways that collectively contribute to the development of osteoporosis-like phenotypes:

  • Canonical Wnt Signaling Pathway:

    • Fzd8 functions as a key receptor in Wnt signal transduction

    • Its knockout disrupts normal Wnt signaling, which is essential for osteoblast differentiation and function

    • Increased Wnt3a protein expression observed in knockout mice suggests a compensatory response to impaired signaling

    • Down-regulation of Fzd10 further compromises Wnt pathway activity

    • Altered expression of Wnt target genes affects osteoblast proliferation, differentiation, and function

  • RANK/RANKL/OPG Axis:

    • Increased RANK protein expression in Fzd8-knockout mice enhances sensitivity to RANKL

    • This leads to increased osteoclast differentiation and activation

    • The resulting imbalance in the RANK/RANKL/OPG ratio favors bone resorption over formation

    • Elevated osteoclast activity contributes to decreased bone mass and compromised bone structure

  • Integrin Signaling:

    • Elevated Itgb3 (integrin beta-3) expression enhances osteoclast adhesion and activity

    • Integrin signaling is crucial for osteoclast cytoskeletal organization and bone resorption

    • Increased integrin signaling contributes to enhanced bone resorption capacity in Fzd8-knockout mice

  • Inflammatory Signaling:

    • Up-regulation of Lta (lipoteichoic acid) indicates enhanced inflammatory signaling

    • Inflammatory cytokines can stimulate osteoclast activity while inhibiting osteoblast function

    • This creates an environment favoring bone resorption over formation

These disrupted molecular pathways interact in complex ways, creating a cellular environment that favors bone resorption over bone formation, resulting in the osteoporosis-like phenotype observed in Fzd8-knockout mice.

What are the optimal methods for developing Fzd8-knockout mouse models using CRISPR/Cas9?

Developing optimal Fzd8-knockout mouse models using CRISPR/Cas9 requires meticulous planning and execution of several critical steps:

  • sgRNA Design and Preparation:

    • Design multiple single guide RNAs (sgRNAs) targeting critical exons of the Fzd8 gene

    • For targeting exon 3 of Fzd8, effective sgRNA sequences include:

      • 5'-AGGGAGTGGATCTCAAGCCTTGG-3'

      • 5'-TTACTCTGGGAGGTAGGGAGTGG-3'

      • 5'-CCGTAGTAAGAAGCTGAGTTAGG-3'

      • 5'-CCAAAGAGAAGGGTGCGGGCGGG-3'

    • Transcribe sgRNAs in vitro using the MEGAshortscript Kit

    • Transcribe Cas9 mRNA using the mMESSAGE mMACHINE T7 Ultra Kit following standard procedures

  • Generation and Validation of First Generation (F0) Mice:

    • Microinject Cas9 mRNA and sgRNAs into fertilized mouse oocytes

    • Transfer injected embryos into pseudopregnant females

    • Verify Fzd8-knockout in F0 mice through PCR using primer pairs:

      • F-5'-CGAACTCTTGGCAGGTCTGT-3'

      • R-5'-ATGCCCATTGGAGCCATGAA-3'

    • Select positive Fzd8-knockout F0 mice for breeding

  • Breeding Strategy for Stable Lines:

    • Mate positive F0 mice with C57BL/6J mice to obtain F1 heterozygous Fzd8-knockout mice

    • Intercross female and male F1 heterozygous mice to produce F2 homozygous Fzd8-knockout mice

    • Use F3 generation mice for experimental analyses to ensure genetic stability

  • Genotyping and Characterization:

    • Develop PCR-based genotyping protocols to distinguish wild-type, heterozygous, and homozygous mice

    • Verify knockout efficiency at both RNA and protein levels using qPCR and Western blot

    • Assess the phenotypic characteristics of knockout mice, including weight and blood parameters

This methodical approach ensures the generation of well-characterized Fzd8-knockout mouse models that provide reliable platforms for investigating the role of Fzd8 in bone development, homeostasis, and osteoporosis.

How can micro-CT analysis be optimized for assessing bone parameters in Fzd8 research?

Optimizing micro-CT analysis for comprehensive assessment of bone parameters in Fzd8 research requires attention to several technical aspects:

  • Scanning System and Parameters:

    • Utilize high-resolution scanning systems such as SkyScan 1176 (Bruker) for optimal image quality

    • Apply consistent scanning parameters across all experimental groups:

      • X-ray voltage: 50-60 kV

      • Current: 500 μA

      • Resolution: 9 μm for trabecular bone, 18 μm for cortical bone

      • Rotation step: 0.5° with frame averaging

    • Maintain consistent sample orientation and positioning within the scanner

  • Sample Preparation and Preservation:

    • Preserve femora by freezing at -40°C to maintain tissue integrity

    • Ensure consistent anatomical landmarks for region of interest (ROI) selection

    • Position samples consistently in the scanner bed to minimize artifacts

  • Image Reconstruction and Processing:

    • Use NRecon software for 3D image reconstruction and viewing

    • Apply appropriate beam hardening correction and ring artifact reduction

    • Use consistent thresholding parameters for segmentation of bone from non-bone tissue

  • Analysis Protocol and Parameters:

    • Employ CTan software (version 1.13 or later) for bone analysis

    • Define standardized regions of interest for:

      • Trabecular bone: Secondary spongiosa region below the growth plate

      • Cortical bone: Mid-diaphyseal region

    • Measure key parameters including:

      • Bone mineral density (BMD) of cortical and trabecular bones

      • Total volume (TV) and bone volume (BV) of cortical bone

      • BV/TV ratio

      • Trabecular number, thickness, and separation

      • Cortical thickness

  • Data Analysis and Interpretation:

    • Compare parameters between wild-type, heterozygous, and homozygous groups

    • Analyze data using appropriate statistical methods, considering P < 0.05 as statistically significant

    • Correlate micro-CT findings with histological, biochemical, and molecular data

This optimized approach ensures the acquisition of comprehensive and reliable bone phenotypic data, essential for characterizing the effects of Fzd8 knockout on bone structure and quality in osteoporosis research.

What protocols are recommended for histological and immunohistochemical analyses of bone tissue in Fzd8-knockout studies?

For optimal histological and immunohistochemical analyses of bone tissue in Fzd8-knockout studies, the following detailed protocols are recommended:

  • Tissue Preparation and Fixation:

    • Fix bone samples with 10% neutral buffered formalin for 24-48 hours

    • Decalcify samples in EDTA solution (10-15%) for 2-3 weeks, changing solution regularly

    • Embed decalcified samples in paraffin

    • Section tissues at 5-7 μm thickness using a microtome

  • Hematoxylin and Eosin (H&E) Staining Protocol:

    • Deparaffinize sections in xylene and rehydrate through graded alcohols

    • Stain with hematoxylin aqueous solution for optimal nuclear visualization

    • Differentiate in acid water and blue in ammonia water

    • Clean under running water for 1 hour

    • Immerse in distilled water and dehydrate in 90% alcohol for 10 minutes

    • Counterstain with eosin

    • Dehydrate, clear, and mount with permanent mounting medium

  • Immunohistochemical (IHC) Staining Protocol:

    • Deparaffinize and rehydrate sections

    • Perform antigen retrieval using citrate buffer (pH 6.0) or EDTA buffer (pH 9.0)

    • Block endogenous peroxidase with 3% hydrogen peroxide

    • Block non-specific binding with serum or protein blocker

    • Incubate with primary antibodies at optimized dilutions:

      • Anti-Itgb3 (integrin beta-3)

      • Anti-RANK (receptor activator of nuclear factor κB)

      • Anti-Wnt3a

    • Apply appropriate secondary antibodies conjugated with horseradish peroxidase

    • Develop with DAB (3,3'-diaminobenzidine) substrate

    • Counterstain with hematoxylin

    • Dehydrate, clear, and mount

  • Analysis and Quantification Methods:

    • Examine H&E-stained sections for osteoblast and osteoclast numbers and morphology

    • Assess bone marrow composition and cellularity

    • For IHC sections, evaluate:

      • Percentage of positively stained cells

      • Staining intensity (weak, moderate, strong)

      • Distribution pattern within the tissue

    • Use high-magnification microscopy (×200) for detailed analysis

    • Employ image analysis software for quantitative assessment

    • Compare protein expression levels between wild-type and Fzd8-knockout mice using appropriate statistical methods

These detailed protocols ensure reproducible and reliable histological and immunohistochemical analyses for investigating the effects of Fzd8 knockout on bone cell populations and protein expressions relevant to bone metabolism and osteoporosis.

What are the best practices for gene expression analysis in Fzd8-related bone research?

Effective gene expression analysis in Fzd8-related bone research requires rigorous methodology and careful experimental design:

  • RNA Extraction and Quality Control:

    • Extract total RNA from bone tissue using optimized protocols for mineralized tissue

    • Assess RNA quality using spectrophotometry (A260/A280 ratio) and gel electrophoresis

    • Verify RNA integrity using bioanalyzers to ensure high-quality starting material

    • Standardize RNA concentrations across all samples prior to downstream applications

  • cDNA Synthesis Protocol:

    • Use RT6 cDNA Synthesis Kit Ver. 2 or equivalent high-fidelity reverse transcription systems

    • Add 5 μL RNA template in each reaction for optimal yield

    • Include appropriate negative controls (no reverse transcriptase) to detect genomic DNA contamination

    • Store cDNA at -20°C for short-term or -80°C for long-term storage

  • Quantitative PCR (qPCR) Optimization:

    • Design gene-specific primers with optimal characteristics:

      • Amplicon size: 80-150 bp

      • Primer length: 18-25 nucleotides

      • GC content: 40-60%

      • Melting temperature: 58-62°C

    • Implement a 3-step fast qPCR protocol:

      • Initial denaturation at 95°C

      • 40 cycles including a 2-second denaturation step at 95°C

      • Include melt curve analysis to verify amplicon specificity

    • Use technical triplicates for each biological sample

    • Include multiple reference genes (e.g., GAPDH, β-actin) for normalization

  • Key Target Genes for Analysis:

    • Wnt signaling pathway components:

      • Frizzled family receptors (especially Fzd10)

      • Wnt ligands (particularly Wnt3a)

      • β-catenin and downstream targets

    • Osteoblast markers:

      • Runx2, Osterix, Osteocalcin, ALP

    • Osteoclast markers:

      • RANK, TRAP, Cathepsin K

    • Inflammatory mediators:

      • Lta and other cytokines

  • Data Analysis and Interpretation:

    • Calculate relative gene expression using the 2^(-ΔΔCt) method

    • Apply appropriate statistical tests (t-test or ANOVA) with P < 0.05 considered statistically significant

    • Present data as mean ± standard deviation with appropriate graphical representation

    • Correlate gene expression changes with protein expression and phenotypic alterations

By following these best practices, researchers can obtain reliable and reproducible gene expression data that provides valuable insights into the molecular mechanisms underlying the effects of Fzd8 on bone metabolism and osteoporosis pathogenesis.

How can bioinformatics approaches be leveraged to analyze transcriptomic data in Fzd8-knockout mouse models?

Bioinformatics approaches significantly enhance the analysis of transcriptomic data in Fzd8-knockout mouse models, providing comprehensive insights into molecular mechanisms:

  • Differential Gene Expression Analysis:

    • Identify up-regulated and down-regulated genes based on log2(Fold Change) values and statistical significance (P < 0.05)

    • Quantify gene expression using fragments per kilobase of exon per million mapped fragments (FPKM)

    • Apply appropriate normalization methods to account for technical variations

    • Implement robust statistical models that consider biological replicates and experimental design

  • Sample Clustering and Correlation Analysis:

    • Cluster samples based on differentially expressed genes (DEGs) to identify patterns

    • Analyze correlations between samples according to phenotypes using Pearson correlation test

    • Calculate Pearson values regarding homogeneous mice to assess genetic consistency

    • Visualize sample relationships using principal component analysis (PCA) or t-SNE

  • Functional Enrichment Analysis:

    • Perform gene ontology (GO) enrichment analysis to identify overrepresented biological processes, molecular functions, and cellular components

    • Conduct pathway enrichment analysis using databases such as KEGG, Reactome, or WikiPathways

    • Use q values to denote significance levels in transcriptomic expressions of molecular processes

    • Identify signaling pathways disrupted by Fzd8 knockout, particularly those related to bone metabolism

  • Advanced Genomic Feature Analysis:

    • Analyze exon-level changes and alternative splicing events induced by Fzd8 knockout

    • Identify single nucleotide polymorphisms (SNPs) associated with exon expression

    • Examine copy number variations (CNVs) related to Fzd8 deficiency

    • Investigate potential off-target effects of CRISPR/Cas9 editing

  • Integration with Phenotypic Data:

    • Correlate transcriptomic changes with bone phenotypic parameters

    • Develop predictive models linking gene expression patterns to bone structural outcomes

    • Identify potential biomarkers for osteoporosis based on Fzd8-regulated genes

    • Construct gene regulatory networks to elucidate the complex interactions governing bone homeostasis

By leveraging these bioinformatics approaches, researchers can gain deeper insights into the complex molecular changes associated with Fzd8 knockout, facilitating the identification of potential therapeutic targets and mechanisms for osteoporosis treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.