Recombinant Mouse Frizzled-9 (Fzd9)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Wnt Signaling Pathways

Fzd9 primarily mediates non-canonical Wnt signaling, though it also participates in canonical pathways under specific conditions:

PathwayMechanismExperimental Evidence
Non-Canonical WntRegulates calcium flux, planar cell polarity, and osteoblast differentiationActivates PPARγ, Sprouty, and Cadherin expression
Canonical Wnt/β-cateninModulates β-catenin stabilization and TCF transcriptional activityInduced by Wnt-2 in 293T cells; requires intact Wnt-binding domain

In bone tissue, Fzd9 knockout mice exhibit reduced bone mineralization due to impaired osteoblast function, despite normal Runx2 and osteocalcin expression .

Applications in Research

Recombinant Fzd9 is used to study:

Bone Formation and Fracture Healing

  • Intramembranous/Endochondral Ossification: Fzd9-deficient mice show 30–45% reduction in bone formation rates and 21–30% lower bone volume fraction (BV/TV) during fracture healing .

  • Osteoblast Defects: Fzd9-null osteoblasts display diminished mineralization capacity and altered chemokine profiles (e.g., reduced Isg15 expression) .

Neurodevelopment and Hippocampal Function

  • Dentate Gyrus Development: Fzd9 knockout mice exhibit increased apoptosis and granule cell loss, leading to visuospatial learning deficits .

  • Williams Syndrome: Heterozygous Fzd9 deletion contributes to neurocognitive phenotypes in this disorder .

Bone Metabolism

  • Mechanical Defects: Fzd9 deficiency correlates with reduced bone mineral density (BMD) and poor fracture callus quality .

  • Downstream Targets: Fzd9 regulates Isg15 and chemokine expression in osteoblasts, independent of canonical Wnt signaling .

Neurodevelopment

  • Apoptosis and Proliferation: Fzd9 nulls show increased apoptosis in the dentate gyrus but compensatory mitotic activity in mossy cells .

  • Behavioral Impact: Impaired performance in hippocampus-dependent spatial learning tasks .

Challenges and Future Directions

  • Signal Specificity: Distinguishing canonical vs. non-canonical Fzd9 signaling in different tissues remains complex .

  • Therapeutic Potential: Targeting Fzd9 may offer novel strategies for bone disorders (e.g., osteoporosis) or neurodevelopmental diseases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Fzd9; Fzd3; Frizzled-9; Fz-9; mFz3; mFz9; CD antigen CD349
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-592
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
LEIGRFDPERGRGPAPCQAMEIPMCRGIGYNLTRMPNLLGHTSQGEAAAQLAEFSPLVQY GCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARL PTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPPGDSAPGPGSGGTCDNPEKF QYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLLEPHRFQY PERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYY FGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGD ELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTNTEKLE KLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCTAATVPGGRRDCSLPGG SVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKMAAGRARAKACRTPGGYG RGTHCHYKAPTVVLHMTKTDPSLENPTHL
Uniprot No.

Target Background

Function
Frizzled-9 (FZD9) is a receptor for WNT2 that is coupled to the beta-catenin canonical signaling pathway. This pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. FZD9 plays a crucial role in neuromuscular junction (NMJ) assembly by negatively regulating the clustering of acetylcholine receptors (AChR) through the beta-catenin canonical signaling pathway. It may also play a role in neural progenitor cells (NPCs) viability through the beta-catenin canonical signaling pathway by negatively regulating cell cycle arrest, leading to inhibition of neuronal apoptotic processes. During hippocampal development, FZD9 regulates neuroblast proliferation and apoptotic cell death. It also controls bone formation through non-canonical Wnt signaling mediated via ISG15 and positively regulates bone regeneration through non-canonical Wnt signaling.
Gene References Into Functions
  1. Research findings indicate that FZD9 and heterotrimeric G proteins regulate Wnt-5a signaling and dendritic spines in cultured hippocampal neurons. PMID: 27402827
  2. Studies have demonstrated that the Wnt serpentine receptor Frizzled-9 regulates new bone formation during fracture healing. PMID: 24391920
  3. Data suggests that Fzd9 is induced upon osteoblast differentiation, and Fzd9(-/-) mice exhibit low bone mass due to impaired bone formation. PMID: 21402791
  4. Results indicate that adult spiral ganglion neurons are prepared to respond to neurite damage due to the constitutive expression of a diverse collection of guidance receptors, including Fzd9. PMID: 19716861
  5. Transgenic mice were generated using the putative control elements of the Fzd9 gene, which is normally selectively expressed in the developing and adult hippocampus. PMID: 15354291
  6. Frizzled 9 is a critical determinant of hippocampal development. PMID: 15930120
  7. Frizzled9 expression markers serve as a regional marker of medially derived cortical derivatives throughout rodent life and will be a useful tool in investigating the regulation of cortical arealization. PMID: 15939089

Show More

Hide All

Database Links

KEGG: mmu:14371

STRING: 10090.ENSMUSP00000053551

UniGene: Mm.6256

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
In the embryo, found in the neural tube, trunk skeletal muscle precursors (myotomes), limb skeletal anlagen, craniofacial regions and nephric ducts. In the adult, expression is abundant in heart, brain, testis and skeletal muscle. In the testis, expressed

Q&A

What is Recombinant Mouse Frizzled-9 and what are its structural characteristics?

Recombinant Mouse Frizzled-9 belongs to the Frizzled family of seven-transmembrane glycoprotein receptors that serve as signaling receptors for secreted Wnt ligands. The mature mouse Frizzled-9 protein consists of three main structural components: a 207 amino acid N-terminal extracellular domain (ECD), a seven-transmembrane (7TM) region, and a 62 amino acid C-terminal cytoplasmic domain containing a PDZ binding motif. The ECD includes a highly conserved cysteine-rich region that is responsible for binding Wnt proteins. Within amino acids 23-186 of the N-terminal ECD, mouse Frizzled-9 shares 97% identity with human Frizzled-9 and 100% identity with rat Frizzled-9, indicating strong evolutionary conservation of this receptor .

How does Frizzled-9 participate in signaling pathways?

Frizzled-9 can signal through both canonical and non-canonical Wnt pathways. In the canonical pathway, binding of Wnt ligands to Frizzled-9 results in inhibition of β-catenin degradation, leading to β-catenin accumulation and subsequent transcription of β-catenin/LEF-inducible genes. This pathway is known to play crucial roles in development, tumorigenesis, and stem cell self-renewal. Research has shown that Frizzled-9 binding to Wnt-7a promotes the activation of PPAR gamma, expression of Cadherin and Sprouty, and can reverse transformation in non-small cell lung cancer cells . Additionally, Wnt-5a/Frizzled-9 receptor signaling through the G𝛼o/G𝛽𝛾 complex has been implicated in dendritic spine formation, highlighting its importance in neuronal development .

What is the expression pattern of Frizzled-9 in normal tissues?

Frizzled-9 exhibits a tissue-specific expression pattern that varies throughout development and in adult tissues. During embryonic development, Frizzled-9 mRNA is primarily expressed in the central nervous system (CNS) and myotomes. This expression persists in the hippocampus throughout life, suggesting an important role in hippocampal function. In adult mice, Northern blot analysis has revealed abundant Frizzled-9 expression in heart, brain, skeletal muscle, kidney, and testis . At the cellular level, Frizzled-9 expression has been detected in proliferating neural precursors, B lymphocyte progenitors, differentiating osteoblasts, and developing myotubes of skeletal muscle. Within the B-cell developmental pathway specifically, Frizzled-9 mRNA is expressed throughout B-cell development but appears to be upregulated in Hardy fractions B to C, consistent with its role in early B-cell development .

How should researchers properly reconstitute and store Recombinant Mouse Frizzled-9 Fc Chimera Protein?

For optimal experimental results, Recombinant Mouse Frizzled-9 Fc Chimera Protein is typically supplied in lyophilized form from a 0.2 μm filtered solution in PBS. The recommended reconstitution protocol involves reconstituting the protein at a concentration of 500 μg/mL in PBS. After reconstitution, it's critical to store the protein properly to maintain its activity. The protein should be stored in a manual defrost freezer, and repeated freeze-thaw cycles should be avoided as they can compromise protein stability and activity. When shipping is necessary, the product should be transported with polar packs, and upon receipt, it should be immediately stored at the recommended temperature .

How can researchers verify the functional activity of Recombinant Mouse Frizzled-9 in experimental settings?

Verifying the functional activity of Recombinant Mouse Frizzled-9 is essential for ensuring experimental validity. One approach is to conduct bioassays measuring the protein's ability to bind its Wnt ligands and trigger downstream signaling events. Previous research has utilized Recombinant Mouse Frizzled-9 in bioassays investigating Wnt-5a/Frizzled-9 receptor signaling through the G𝛼o/G𝛽𝛾 complex in dendritic spine formation .

Researchers can also verify functionality by examining the protein's ability to influence β-catenin signaling, using reporter assays with β-catenin/LEF-responsive elements. Additionally, cellular assays measuring changes in target gene expression, such as PPAR gamma, Cadherin, or Sprouty genes, following treatment with both Recombinant Mouse Frizzled-9 and appropriate Wnt ligands can provide evidence of functional activity. For studies focusing on B-cell development, functionality can be assessed by the protein's ability to rescue developmental defects in Frizzled-9 deficient cell lines or primary cells from Fzd9 knockout mice, particularly focusing on the pre-B cell stage where Frizzled-9 appears to play a critical role .

How can Recombinant Mouse Frizzled-9 be utilized to study B-cell development pathways?

Recombinant Mouse Frizzled-9 provides a powerful tool for investigating B-cell development pathways, particularly at the pre-B cell stage where Frizzled-9 knockout mice show significant defects. Researchers can use the recombinant protein in ex vivo culture systems to examine its effect on B-cell development and proliferation. One methodological approach involves isolating bone marrow cells from Fzd9-/- mice and culturing them with recombinant Frizzled-9 to assess rescue of developmental defects. Flow cytometric analysis can then be performed to evaluate B-cell populations at different developmental stages, particularly focusing on Hardy fractions B to C, where Frizzled-9 expression is elevated .

Additionally, the recombinant protein can be employed in competitive bone marrow reconstitution studies to investigate the cell-intrinsic versus extrinsic roles of Frizzled-9 in B-cell development. Previous research has demonstrated that Fzd9-/--derived bone marrow exhibits defective B-cell development when implanted into a wild-type host, indicating a partially cell-intrinsic defect. This approach involves transplanting a mixture of wild-type and Fzd9-/- bone marrow cells (differentially labeled) into irradiated recipients, then analyzing the relative contribution of each donor population to different B-cell developmental stages over time .

What insights can be gained from studying Wnt-Frizzled-9 interactions in neurological development?

Studying Wnt-Frizzled-9 interactions using recombinant proteins offers significant insights into neurological development, particularly regarding dendritic spine formation and hippocampal function. Researchers can design experiments using Recombinant Mouse Frizzled-9 in primary neuronal cultures to examine its interactions with different Wnt ligands and subsequent effects on dendritic spine morphology and density. Previous research has specifically identified a role for Wnt-5a/Frizzled-9 receptor signaling through the G𝛼o/G𝛽𝛾 complex in regulating dendritic spine formation .

Methodologically, calcium imaging can be employed to study non-canonical Wnt signaling through Frizzled-9, while reporter assays can be used to examine canonical pathway activation. Additionally, high-resolution microscopy techniques can visualize changes in dendritic spine morphology following manipulation of Frizzled-9 activity. These approaches are particularly relevant given that the human FZD9 gene maps to a region deleted in Williams-Beuren syndrome (WBS), a neurodevelopmental disorder. Though Fzd9-/- mice do not exhibit obvious WBS-like features, understanding the specific neurological functions of Frizzled-9 may provide insights into particular aspects of complex neurodevelopmental disorders .

How does Frizzled-9 contribute to bone mineralization and what methodologies can researchers use to study this process?

Frizzled-9 has been implicated in bone mineralization processes, as mice lacking this receptor exhibit defects in bone mineralization. To study this aspect of Frizzled-9 function, researchers can employ multiple complementary approaches. Recombinant Mouse Frizzled-9 can be used in in vitro osteoblast differentiation assays, where primary osteoblast precursors are cultured in differentiation media with or without the recombinant protein to assess its impact on differentiation markers, mineralization, and gene expression profiles .

Micro-computed tomography (micro-CT) analysis of bone samples from Fzd9-/- mice compared to wild-type controls can provide quantitative data on bone mineral density, bone volume, and microarchitecture. Histomorphometric analysis using bone sections stained with techniques such as von Kossa or Alizarin Red can further characterize mineralization defects. At the molecular level, researchers can explore the signaling mechanisms by which Frizzled-9 influences osteoblast function through analysis of β-catenin pathway activation and expression of osteoblast-specific genes. Additionally, co-culture systems with osteoblasts and osteoclasts can help elucidate whether Frizzled-9 affects bone mineralization directly through osteoblast function or indirectly through osteoclast regulation .

What controls should be included when studying Frizzled-9 signaling pathways?

When designing experiments to study Frizzled-9 signaling pathways, several controls are essential to ensure reliable and interpretable results. For binding studies, a negative control using an irrelevant Fc-fusion protein with similar structural characteristics should be included to account for non-specific binding. Additionally, competitive binding assays using known Wnt ligands can serve as positive controls for Frizzled-9 binding activity.

For cellular assays examining downstream signaling activation, both positive and negative pathway controls are crucial. Cells treated with established Wnt pathway activators (e.g., GSK3β inhibitors for canonical signaling) serve as positive controls, while cells expressing dominant-negative versions of Frizzled-9 can act as negative controls. When analyzing B-cell development specifically, comparative analysis with cells from wild-type, Fzd9+/-, and Fzd9-/- mice allows for gene-dosage effects to be observed. For reconstitution experiments, controls should include mock-transfected cells, cells expressing non-functional Frizzled-9 mutants, and cells expressing related Frizzled family members to assess specificity .

How can researchers distinguish between canonical and non-canonical Wnt signaling through Frizzled-9?

Distinguishing between canonical and non-canonical Wnt signaling through Frizzled-9 requires multiple complementary approaches. For canonical pathway analysis, researchers can utilize TOPFlash/FOPFlash reporter assays that contain TCF/LEF binding sites upstream of a luciferase reporter gene. Increased luciferase activity following Frizzled-9 stimulation indicates canonical pathway activation. Western blot analysis of β-catenin levels, particularly nuclear β-catenin, provides another measure of canonical signaling, as does qRT-PCR analysis of established β-catenin target genes.

For non-canonical pathway analysis, calcium imaging using fluorescent calcium indicators can detect calcium fluxes associated with the Wnt/Ca2+ pathway. Additionally, activation of JNK or ROCK can be assessed through phospho-specific antibodies to examine PCP pathway activation. Co-immunoprecipitation studies can identify Frizzled-9 interactions with specific downstream effectors characteristic of either canonical (e.g., Dishevelled, GSK3β) or non-canonical (e.g., G-proteins, PKC) pathways. Research has shown that Frizzled-9 can signal through both canonical and non-canonical pathways, with specific evidence for G-protein coupled signaling through the G𝛼o/G𝛽𝛾 complex in dendritic spine formation .

What are the methodological considerations for analyzing Frizzled-9 expression in different cell populations?

Accurate analysis of Frizzled-9 expression in different cell populations requires careful consideration of methodological approaches. At the mRNA level, quantitative RT-PCR provides sensitive detection of Frizzled-9 transcript levels, but requires careful primer design to distinguish between Frizzled family members with high sequence homology. RNA-seq offers a more comprehensive analysis of Frizzled-9 expression in the context of the entire transcriptome. For single-cell analysis, techniques such as single-cell RNA-seq or in situ hybridization can localize Frizzled-9 expression to specific cells within heterogeneous populations.

At the protein level, flow cytometry using specific anti-Frizzled-9 antibodies can quantify cell surface expression across different cell populations. Western blotting provides information on total Frizzled-9 protein levels, while immunofluorescence microscopy offers insights into subcellular localization. For detection of Frizzled-9 in specific hematopoietic subpopulations, multiparameter flow cytometry combining Frizzled-9 staining with established lineage markers (such as B220, CD19, IgM for B-cell development) enables precise characterization of expression patterns throughout differentiation. The approach used in the literature involved flow sorting cells from various mature and progenitor populations to more than 98% purity, followed by one-step RT-PCR on cDNA from 1000 cell equivalents, which revealed expression throughout B-cell development with increased levels in Hardy fractions B to C .

How should researchers interpret phenotypic differences between Frizzled-9 knockout mice and Frizzled-9 neutralization/inhibition experiments?

Researchers should examine whether phenotypic differences between these approaches reflect developmental versus acute roles of Frizzled-9, or indicate compensatory upregulation of other Frizzled family members in knockout models. Analysis of expression patterns of related Frizzled receptors in knockout mice can help identify potential compensatory mechanisms. Additionally, conditional knockout models using inducible Cre-lox systems offer an intermediate approach, allowing for time-specific deletion of Frizzled-9 and potentially circumventing developmental compensation. When interpreting data, researchers should consider that the pre-B cell defect in Fzd9-/- mice is partially intrinsic to the hematopoietic system, as demonstrated in competitive bone marrow reconstitution studies, suggesting cell-autonomous and non-cell-autonomous components to Frizzled-9 function that might be differentially affected by acute versus genetic approaches .

What are potential explanations for discrepancies in Frizzled-9 signaling between in vitro and in vivo studies?

Discrepancies between in vitro and in vivo studies of Frizzled-9 signaling can arise from multiple sources that researchers must consider when interpreting results. In vitro systems often lack the complex microenvironment present in vivo, including the full complement of Wnt ligands, co-receptors, and extracellular matrix components that modulate Frizzled-9 signaling. The expression levels of Frizzled-9 in recombinant systems may differ substantially from physiological levels, potentially altering signaling dynamics or triggering non-physiological pathways.

For B-cell development specifically, the bone marrow microenvironment provides critical niche factors that support different developmental stages. The finding that pre-B cell defects in Fzd9-/- mice are partially intrinsic to the hematopoietic system suggests that both cell-autonomous and non-cell-autonomous factors influence Frizzled-9 function in vivo. Additionally, the temporal aspects of Wnt-Frizzled signaling may differ between acute in vitro experiments and chronic in vivo conditions. To address these discrepancies, researchers should consider using ex vivo culture systems that better recapitulate the in vivo microenvironment, validate in vitro findings with corresponding in vivo experiments, and utilize physiologically relevant concentrations of recombinant proteins that match endogenous expression levels .

How can researchers address redundancy issues when studying Frizzled-9 in the context of multiple Frizzled family members?

Addressing redundancy among Frizzled family members represents a significant challenge in Frizzled-9 research. The mouse genome contains at least 9 Frizzled family members with potentially overlapping functions, which may explain why Fzd9-/- mice display specific rather than global developmental defects. To address this issue, researchers can employ several complementary strategies .

Comprehensive expression profiling of all Frizzled family members in tissues and cells of interest helps identify potential compensatory receptors. This can be achieved through qRT-PCR, RNA-seq, or proteomics approaches. For functional studies, siRNA or CRISPR-based approaches targeting multiple Frizzled receptors simultaneously can reveal synergistic effects masked by redundancy in single knockout models. Domain swap experiments, where specific regions of Frizzled-9 are exchanged with corresponding regions from other family members, can identify unique structural determinants of Frizzled-9 function versus shared features across the family.

Researchers should also consider ligand specificity, as different Wnt ligands exhibit preferential binding to specific Frizzled receptors. Competitive binding assays using recombinant Wnt proteins and various Frizzled receptors can map these specificity patterns. Additionally, compound mutant mice lacking multiple Frizzled receptors can reveal phenotypes masked by redundancy in single knockouts. Finally, systems biology approaches integrating protein interaction networks, gene expression data, and phenotypic information across multiple knockout models can provide a more comprehensive understanding of functional overlap and specificity among Frizzled family members .

How might Frizzled-9 research contribute to understanding Williams-Beuren Syndrome pathology?

While Fzd9-/- mice do not exhibit obvious features of Williams-Beuren Syndrome (WBS), continued research into Frizzled-9 function may still provide valuable insights into specific aspects of this complex neurodevelopmental disorder. In humans, the FZD9 gene maps to chromosome 7q11.23, within the 1.4-megabase region deleted in WBS. Methodologically, researchers can investigate potentially subtle behavioral or cognitive phenotypes in Fzd9+/- mice (analogous to the heterozygous deletion in WBS patients) using sophisticated behavioral assays beyond those previously employed .

Additionally, human induced pluripotent stem cells (iPSCs) derived from WBS patients can be genetically engineered to restore FZD9 expression specifically, allowing researchers to determine which cellular phenotypes might be rescued by this single gene within the deletion region. Comparative transcriptomic and proteomic analyses between Fzd9-deficient mouse models and WBS patient samples might reveal shared molecular signatures despite different gross phenotypes. Given the role of Frizzled-9 in dendritic spine formation through Wnt-5a signaling, researchers should particularly focus on potential contributions to the cognitive and neurological aspects of WBS, using high-resolution imaging to examine dendritic spine morphology in both mouse models and human neuronal cultures .

What are the implications of Frizzled-9's role in B-cell development for immunological research?

The role of Frizzled-9 in B-cell development, particularly at the pre-B cell stage, opens several important avenues for immunological research. The finding that Fzd9-/- mice exhibit a depletion of developing B cells in the bone marrow, specifically at the stage where immunoglobulin heavy chains are expressed and cells undergo clonal expansion prior to light chain rearrangement, suggests Frizzled-9 may regulate critical processes in B-cell maturation and proliferation .

Researchers can investigate whether Frizzled-9 signaling influences immunoglobulin gene rearrangement, pre-BCR signaling, or the proliferative response following successful heavy chain expression. Methodologically, this can be approached using in vitro differentiation systems where hematopoietic stem cells are induced to differentiate along the B-cell lineage with or without Frizzled-9 signaling manipulations. The observation that Fzd9-/- mice develop lymphadenopathy with accumulation of plasma cells in lymph nodes also warrants investigation into potential roles for Frizzled-9 in regulating terminal B-cell differentiation or plasma cell homeostasis .

Additionally, the impact of Frizzled-9 deficiency on humoral immune responses to T-dependent and T-independent antigens should be systematically evaluated. Given the interconnections between Wnt signaling and other pathways relevant to immune function, researchers should explore potential crosstalk between Frizzled-9 and established regulators of B-cell development such as IL-7, BAFF/APRIL, and BCR signaling components .

How can advanced genome editing technologies enhance our understanding of Frizzled-9 function?

Advanced genome editing technologies, particularly CRISPR-Cas9, offer powerful new approaches for investigating Frizzled-9 function with unprecedented precision. Researchers can generate knock-in models expressing tagged versions of Frizzled-9 at endogenous levels to track the receptor's expression, localization, and interaction partners without overexpression artifacts. Domain-specific mutations can be introduced to dissect the functional importance of different Frizzled-9 structural elements, such as the cysteine-rich domain, transmembrane domains, or PDZ-binding motif .

Methodologically, inducible and tissue-specific CRISPR systems allow for temporal and spatial control of Frizzled-9 disruption, enabling researchers to bypass developmental requirements and study the receptor's function in adult tissues or specific cell populations. Base editing technologies can be employed to introduce or correct specific point mutations associated with altered Frizzled-9 function, allowing for precise genotype-phenotype correlations. For studying complex developmental processes, lineage tracing systems combined with Frizzled-9 manipulation can reveal the fate of cells following receptor disruption at defined developmental stages .

In B-cell research specifically, CRISPR screens targeting multiple components of Wnt-Frizzled signaling pathways in primary B cells or B-cell lines can systematically identify key nodes in the network influencing B-cell development and function. Finally, humanized mouse models expressing human FZD9 in place of the mouse ortholog may provide more translatable insights into the receptor's function in human biology and pathology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.