Recombinant Mouse Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2 (Cmtr2)

Shipped with Ice Packs
In Stock

Description

Protein Sequence and Domains

The full target protein sequence of Mouse Cmtr2 is extensive and contains various functional domains essential for its methyltransferase activity . The protein's sequence is characterized by specific regions that enable substrate recognition, binding, and catalytic activity. The recombinant version typically includes an N-terminal His-tag to facilitate purification and detection in experimental settings .

CharacteristicDescription
UniProtKB IDQ8BWQ4
Full NameCap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2
SynonymsCap methyltransferase 2, Cap2 2'O-ribose methyltransferase 2, MTr2, FtsJ methyltransferase domain-containing protein 1
SpeciesMus musculus (Mouse)
Molecular Weight90.0 kDa
Protein Length767 amino acids (full length)
Expression Range1-767aa

Production and Purification

Recombinant Mouse Cmtr2 protein is typically produced using E. coli expression systems, which allow for efficient production of the full-length protein with an N-terminal 10-histidine tag . The expression system is designed to yield high quantities of the functional protein while maintaining its enzymatic capabilities.

The purification process typically achieves greater than 85% purity as determined by SDS-PAGE analysis . The recombinant protein can be provided in either liquid form or as a lyophilized powder, depending on the specific research requirements . This flexibility in formulation enables various experimental applications and storage conditions.

Expression and Purification Methods

The production of recombinant Cmtr2 involves several steps, including gene cloning, expression optimization, protein extraction, and purification. The addition of the His-tag facilitates purification through affinity chromatography, allowing for selective isolation of the target protein from bacterial lysates.

Biological Functions

Cmtr2 plays a critical role in mRNA cap methylation, specifically introducing 2'-O-methylation at the ribose of nucleotides adjacent to the 5' cap structure . Research has demonstrated that Cmtr2 can methylate the ribose of the first nucleotide in mRNA, a function that had previously been less understood .

Studies in Drosophila have shown that while Cmtr1 (a related cap methyltransferase) is the major enzyme responsible for introducing cap O-methylation (cOMe), Cmtr2 has a more specialized and targeted role in this process . Unlike earlier assumptions that Cmtr2 specifically methylates the second nucleotide of mRNAs, research now indicates that both Cmtr1 and Cmtr2 can methylate the first nucleotide, potentially depending on the sequence context .

Cap Methylation Mechanism

The methylation of cap-adjacent nucleotides represents a significant post-transcriptional modification mechanism that influences gene expression. This process occurs co-transcriptionally, as evidenced by the association of Cmtr2 with specific genes during transcription . The methylation introduced by Cmtr2 contributes to the complex landscape of mRNA modifications that regulate mRNA stability, nuclear export, and translation efficiency.

Target Specificity

One of the distinguishing features of Cmtr2 is its high target specificity. Unlike Cmtr1, which co-localizes extensively with RNA Polymerase II and appears to have a broader range of targets, Cmtr2 is prominently localized to only a subset of transcribed genes . This observation suggests that Cmtr2 has evolved to methylate a more specific set of mRNA transcripts.

Cross-linking and immunoprecipitation (CLIP) experiments have identified 762 genes as potential targets for Cmtr2, with 117 classified as high-confidence targets (showing at least 3-fold enrichment) . These targets predominantly include genes involved in cellular signaling pathways, ion channels, synaptic vesicle release, and cell adhesion molecules .

Target Gene Categories

The target specificity of Cmtr2 appears to have functional significance, as many of its target genes are involved in neurological processes and cellular communication.

Functional CategoryDescription of Cmtr2 Target Genes
Cellular SignalingIncludes various signal transduction pathways important for cell-cell communication
Ion ChannelsProteins involved in regulating ion flow across cell membranes
Synaptic Vesicle ReleaseComponents of the machinery required for neurotransmitter release
Cell AdhesionMolecules that facilitate cell-cell and cell-matrix interactions

Additionally, Cmtr2 seems to preferentially target transcripts that start with adenosine (A), further highlighting its sequence-specific activity .

Neurological Significance

Interestingly, the learning defects observed in flies lacking Cmtr1 and Cmtr2 can be rescued by conditional expression of these enzymes in mushroom body neurons before training, further supporting their importance in neurological function . This role in learning processes aligns with the observation that many Cmtr2 targets are genes involved in synaptic function and cellular signaling, which are critical for neural plasticity and memory formation.

Relationship to mRNA Localization and Translation

Research indicates that cap O-methylation is required for the localization of untranslated mRNAs to synapses and enhances binding of the cap binding complex in the nucleus . This function parallels that of Fragile X Mental Retardation Protein (FMRP), and many Cmtr2 targets are also FMRP targets . This suggests a potential role for Cmtr2 in co-transcriptionally priming mRNAs for localized protein synthesis at synapses, a process critical for synaptic plasticity and learning.

Comparative Analysis with Cmtr1

Both Cmtr1 and Cmtr2 are cap methyltransferases capable of introducing 2'-O-methylation at the ribose of cap-adjacent nucleotides, but they exhibit distinct patterns of expression, target specificity, and biological roles.

CharacteristicCmtr1Cmtr2
Target RangeBroader range of targets, co-localizes extensively with RNA Pol IIMore specific set of targets, localizes to a subset of transcribed genes
Number of CLIP Targets3109 genes (1146 high-confidence)762 genes (117 high-confidence)
Knockout Phenotype in MiceEmbryonic lethal, leads to neurological defectsNot specifically reported for mice
Function in DrosophilaMajor enzyme for introducing cOMeMore specialized role, targets specific gene sets
Chromosomal AssociationWidespread across transcribed genesLimited to specific gene subsets

Mutations and Disease Associations

The COSMIC (Catalogue Of Somatic Mutations In Cancer) database includes information on mutations in the CMTR2 gene that may be relevant to cancer . The database catalogs various mutation types, including single base substitutions, insertions, and deletions, providing insights into potential roles of CMTR2 in pathological conditions .

While the specific functional consequences of these mutations are not fully elucidated, the presence of CMTR2 in cancer mutation databases suggests potential roles in cellular processes relevant to oncogenesis or tumor suppression.

Research Applications

Recombinant Mouse Cmtr2 protein has various applications in research settings, particularly in studies focused on mRNA modification, processing, and translation. The availability of purified recombinant protein facilitates investigations into the enzyme's substrate specificity, catalytic mechanism, and interactions with other components of the mRNA processing machinery.

Experimental Uses

The recombinant protein can be utilized in:

  • In vitro methylation assays to study the enzyme's activity on different RNA substrates

  • Structural studies to elucidate the three-dimensional organization of the protein

  • Protein-protein interaction studies to identify binding partners

  • Development of inhibitors or activators for functional studies

Additionally, the recombinant protein can serve as a positive control or standard in assays designed to measure cap methylation or to validate antibodies targeting Cmtr2.

Future Research Directions

Despite significant advances in understanding Cmtr2 function, several areas warrant further investigation. Future research directions might include:

  1. Elucidating the detailed three-dimensional structure of Cmtr2 to better understand its catalytic mechanism

  2. Investigating the regulatory mechanisms that control Cmtr2 expression and activity

  3. Exploring the potential roles of Cmtr2 in various pathological conditions, including neurodevelopmental disorders and cancer

  4. Developing tools to manipulate Cmtr2 activity for potential therapeutic applications

  5. Further characterizing the sequence specificity of Cmtr2 and how it selects its target transcripts

Product Specs

Description

The recombinant Mouse Cmtr2 protein is produced using a cell-free in vitro expression system derived from *E. coli*. This system allows for the synthesis of the full-length protein without the need for cell culture. The cell-free extract contains all the necessary components for transcription, translation, and post-translational modifications of the recombinant protein. By supplementing with cofactors, Cmtr2 proteins can be generated within a few hours. However, this system is not suitable for large-scale production of recombinant proteins. Its advantages include the ability to synthesize proteins without cell culturing and the potential to express multiple proteins simultaneously.

Cmtr2 is a second transcribed nucleotide ribose O-2 methyltransferase found in both the nucleus and cytoplasm of MCF7 cells. It exhibits methyltransferase activity on the second transcribed nucleotide (cap2) at the 2'-prime-O-ribose position of capped mRNA and small nuclear RNA. Research has shown that Cmtr2 can methylate substrates, regardless of the methylation status of the cap guanosine or N1 ribose. Mutations in Cmtr2 have been identified in patients with lung adenocarcinomas.

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request as much as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cmtr2; Ftsjd1; Cap-specific mRNA; nucleoside-2'-O--methyltransferase 2; Cap methyltransferase 2; Cap2 2'O-ribose methyltransferase 2; MTr2; FtsJ methyltransferase domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-767
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cmtr2
Target Protein Sequence
MSKRRKLPARQPACLETFSPDVLNDVSELFAKSFSYRKPLDNEWQLPAPTESFSCGHLEF RALLDLKNSLNEVKNLLSDKKLDEWHRHTAFTNKAGKIISHVKKAVNAELCTQAWCKFQE ILCSFPLIPQEAFQSGRLNSLHLCEAPGAFIASLNHYLKSHRFPCEWSWVANSLNPYHEA NDNLRMITDDRLMANTLHCWYFGPDNTGDIMTLKYLTGLQDFLSGMSPIHLVTADGSFDC QGNPGEQEALVSSLHYCEAVTALITLGDGGSFVLKMFTLFEHCSVNLMYLLNCSFDQVHV FKPATSKAGNSEVYVVCLRYKGREAVQPLLSRMVLNFGTEMTRKALFPHHVIPKSFLERH EECCTFFHRYQLETISENIRLFESMGTGEQERLNNLRDCAVQYFMQKFQLKPLSRNHWLV KKSNIGCSMNTKWFGQRNKYFKTYNERKMMETLSWKDKVAKGYFNSWAEEHTVYHPGQNS LLEGTASSLEYQSWQVLEGKKLPKVKCSPFCDGEILKTLNEAIEKSLGEALSVDAKVSSK QQYRCCPVFSEESVLSELLRLTKCLPDEQGAEPSGPVKCLLVGSPAVCDLQMPAPLEIQL VESVELTAFSCSLLHDGDPAYQHLFLDCLLHSLRRLHRGDVMVLPILSCFTRFMAGLTFV LHGCFRFITFSCPTSLEPLRTCAVLLCIGYQNLPDAVFQFLQNVHDLLSKLLHPSAPRQI LQFLPMEALLQGTLLDFLWDLNAAIAKRHLHLIIQGERDQAIGSLEL
Uniprot No.

Target Background

Function
S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap2 2'-O-ribose methylation to the 5'-cap structure of mRNAs. Methylates the ribose of the second nucleotide of a m(7)GpppG-capped mRNA and small nuclear RNA (snRNA) (cap0) to produce m(7)GpppRmpNm (cap2). Recognizes a guanosine cap on RNA independently of its N(7) methylation status. Exhibits cap2 methylation on both cap0 and cap1. Displays a preference for cap1 RNAs.
Database Links
Subcellular Location
Nucleus. Cytoplasm.

Q&A

What is Cmtr2 and what is its primary function in RNA biology?

Cmtr2 (Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2) is an enzyme that catalyzes the 2'-O-methylation specifically of the second transcribed nucleotide in mRNA cap structures. This enzyme contains a unique Rossmann fold methyltransferase domain known as Ftsj, which is essential for its catalytic activity. Unlike its counterpart Cmtr1 (which methylates the first transcribed nucleotide), Cmtr2 has distinct functional domains flanking its Ftsj methyltransferase domain and functions primarily in the cytoplasm rather than the nucleus in mammalian cells. This methylation is part of the cap2 structure formation, which plays crucial roles in mRNA processing, stability, translation efficiency, and potentially in distinguishing "self" from "non-self" RNA during immune responses .

How does Cmtr2 differ structurally and functionally from Cmtr1?

While both Cmtr1 and Cmtr2 are involved in mRNA cap methylation, they exhibit significant differences:

FeatureCmtr1Cmtr2
Target positionFirst transcribed nucleotideSecond transcribed nucleotide
Cellular localizationPredominantly nuclearPrimarily cytoplasmic
Interaction with RNA Pol IIInteracts directly via WW domainNo direct interaction reported
Impact on translationCan boost protein productionCan strongly decrease translation
Cancer dependencyHigher dependency (mean score -0.79)Lower dependency (mean score -0.08)

Cmtr1 interacts directly with RNA polymerase II via its WW domain, preferentially binding to Ser-5 phosphorylated C-terminal domains (CTDs), which allows it to be recruited effectively to transcription start sites. This interaction correlates with RNA polymerase II abundance and is not observed with Cmtr2. The two enzymes also differ in their structural domains, despite sharing a common Ftsj methyltransferase domain .

What is the significance of 2'-O-methylation of the second transcribed nucleotide?

The 2'-O-methylation of the second transcribed nucleotide (creating what's known as a cap2 structure) has significant biochemical and biological implications. Studies have shown that this specific modification can:

  • Regulate protein biosynthesis in a cell-specific manner

  • Strongly influence protein production levels, often hampering translation efficiency

  • Significantly alter the composition of protein interactomes associated with the modified RNA

  • Serve as a determinant for defining transcripts as "self" during innate immune responses

  • Contribute to transcript escape from host immune surveillance

These effects demonstrate that cap2 methylation is not merely a structural feature but plays active roles in translation regulation and immune evasion mechanisms .

What are the recommended methods for detecting and quantifying mouse Cmtr2 in biological samples?

For detecting and quantifying mouse Cmtr2 in biological samples, several complementary approaches are recommended:

  • ELISA-based quantification: Commercial ELISA kits (such as the one described in search result ) can quantitatively detect Cmtr2 in tissue homogenates, cell lysates, and other biological fluids with a test range of 0.156-10 ng/ml. This colorimetric method provides specific and sensitive detection.

  • Western blotting: For protein expression analysis, western blotting using specific anti-Cmtr2 antibodies can be employed. When conducting western blot analysis, it's important to include appropriate positive and negative controls and standardize protein loading.

  • qRT-PCR: For mRNA expression analysis, quantitative real-time PCR using specific primers targeting the Cmtr2 gene (GeneID: 234728) can be utilized.

  • RNA-Seq analysis: For transcriptomic studies, RNA-Seq can provide comprehensive insights into Cmtr2 expression patterns across different tissues or experimental conditions.

For optimal results, samples should be diluted to mid-range concentrations of the detection method, and experiments should be conducted under consistent conditions to minimize performance fluctuations .

How can researchers effectively produce and purify recombinant mouse Cmtr2 for in vitro studies?

To effectively produce and purify recombinant mouse Cmtr2:

  • Expression system selection: A mammalian expression system (typically HEK293 or CHO cells) is recommended for producing functional mouse Cmtr2 with proper post-translational modifications. Bacterial systems may yield protein with different tertiary structures than the native form.

  • Construct design:

    • Clone the full mouse Cmtr2 sequence (UniProt: Q8BWQ4) into an appropriate mammalian expression vector

    • Include a purification tag (His6, FLAG, or GST) at either the N- or C-terminus

    • Consider including a protease cleavage site to remove the tag after purification

  • Purification protocol:

    • Harvest cells and lyse using a buffer containing protease inhibitors

    • Perform affinity chromatography using the appropriate resin for the chosen tag

    • For higher purity, follow with size exclusion chromatography

    • Verify protein identity via mass spectrometry and activity via methyltransferase assays

  • Storage conditions: Store purified protein at -80°C in small aliquots to avoid freeze-thaw cycles. Include glycerol (10-20%) for stability.

It's important to note that recombinant proteins may have different sequences or tertiary structures compared to the native protein, which might affect functional studies .

What methods can be used to assess the methyltransferase activity of recombinant Cmtr2?

To assess the methyltransferase activity of recombinant Cmtr2, researchers can employ several methodological approaches:

  • In vitro methyltransferase assays:

    • Incubate purified Cmtr2 with capped RNA substrate (containing an unmethylated second nucleotide) and S-adenosylmethionine (SAM, methyl donor)

    • Detect methylation using:

      • Radiolabeled SAM (³H or ¹⁴C-labeled) followed by scintillation counting

      • HPLC or mass spectrometry analysis of methylated RNA products

      • Antibodies specific to 2'-O-methylated caps

  • Tetranucleotide cap analog incorporation:

    • Use chemically synthesized tetranucleotide cap analogs (m7GpppNpNm) for co-transcriptional capping during in vitro transcription

    • Compare RNA with and without 2'-O-methylation at the second position

    • Analyze translation efficiency and protein interactome differences

  • Thin Layer Chromatography (TLC):

    • Digest the capped RNA with nucleases after the methylation reaction

    • Separate the cap structures on TLC plates

    • Visualize and quantify the reaction products

  • Reporter systems:

    • Create reporter constructs with differentially methylated cap structures

    • Transfect into cells and measure reporter expression

    • Compare results between wild-type and Cmtr2-knockdown cells

These methods provide complementary approaches to thoroughly characterize the activity and specificity of recombinant Cmtr2.

How is Cmtr2 expression regulated in normal tissues versus cancer tissues?

Cmtr2 expression shows notable differences between normal and cancerous tissues, with evidence of complex regulation at both the transcriptional and post-transcriptional levels:

  • mRNA expression patterns:

    • Cmtr2 shows significantly decreased RNA levels in multiple tumor types compared to normal adjacent tissues, including:

      • Breast cancer (BRCA)

      • Head and neck cancer (HNSC)

      • Liver cancer (LIHC)

      • Kidney cancers (KIRC and KIRP)

      • Lung cancers (LUAD and LUSC)

      • Prostate adenocarcinoma (PRAD)

      • Endometrial carcinoma (UCEC)

  • Protein expression patterns:

    • Interestingly, despite reduced mRNA levels, Cmtr2 protein was significantly upregulated in several tumor types:

      • Head and neck cancer (HNSC)

      • Kidney clear cell carcinoma (KIRC)

      • Lung adenocarcinoma (LUAD)

      • Lung squamous cell carcinoma (LUSC)

  • Post-transcriptional regulation:

    • The discrepancy between mRNA and protein levels suggests an additional layer of regulation for Cmtr2 protein expression, independent of mRNA expression, in certain tumor types

    • This may involve altered translation efficiency, protein stability, or post-translational modifications

These findings highlight the complex nature of Cmtr2 regulation in cancer and suggest that protein expression analysis, rather than just transcriptomic data, is essential for understanding its role in pathological processes.

What is the relationship between Cmtr2 activity and innate immune responses?

Cmtr2-mediated 2'-O-methylation of the second transcribed nucleotide plays a significant role in modulating innate immune responses:

  • Self vs. non-self RNA discrimination:

    • 2'-O-methylation of the second transcribed nucleotide serves as a determinant for defining transcripts as "self"

    • This modification, along with N6-methylation of adenosine as the first transcribed nucleotide, contributes to transcript escape from host innate immune recognition

  • Immune sensor evasion mechanism:

    • Properly methylated cap structures help mRNAs avoid detection by pattern recognition receptors (PRRs) such as RIG-I, MDA5, and IFIT proteins

    • This is particularly important in distinguishing cellular mRNAs from viral RNAs, which often lack complete cap methylation

  • Implications in viral infection:

    • Some viruses have evolved mechanisms to mimic host cap methylation patterns to evade immune detection

    • Understanding Cmtr2 function provides insights into these viral immune evasion strategies

  • Cell-specific effects:

    • The impact of cap2 methylation on immune responses may vary depending on cell type and physiological context

    • This variability suggests tissue-specific roles for Cmtr2 in immune regulation

These findings highlight Cmtr2 as a potential target for immunomodulatory interventions and underline its importance in maintaining appropriate immune system function.

How does Cmtr2 methylation status affect translation efficiency and protein production?

The 2'-O-methylation of the second transcribed nucleotide catalyzed by Cmtr2 has profound and complex effects on translation efficiency and protein production:

  • Cell-specific regulation:

    • 2'-O-methylation of the second transcribed nucleotide influences protein production levels in a cell-specific manner

    • The same modification can strongly hamper protein biosynthesis in some cell types while having minimal effect in others

  • Translation regulation:

    • Unlike 2'-O-methylation of the first transcribed nucleotide (by Cmtr1) which can boost protein production, the same modification of the second transcribed nucleotide often strongly decreases translation efficiency

    • This suggests a potential regulatory mechanism for fine-tuning gene expression

  • Protein interactome changes:

    • In certain cell lines (e.g., JAWS II), 2'-O-methylation of the mRNA cap has a prominent impact on the composition of the protein interactome associated with the RNA bearing these modifications

    • This indicates that cap2 structures may recruit specific RNA-binding proteins that influence translation

  • Experimental evidence:

    • Studies using tetranucleotide cap analogs have demonstrated that the presence of 2'-O-methylation at the second transcribed nucleotide can significantly alter protein synthesis outcomes

    • These effects appear to be independent of the nucleotide identity (adenosine or other bases)

These findings highlight the importance of Cmtr2-mediated methylation as a regulatory mechanism for post-transcriptional gene expression control.

How can computational modeling be utilized to predict Cmtr2 substrate specificity and activity?

Computational modeling offers powerful approaches for predicting Cmtr2 substrate specificity and activity:

These computational approaches provide valuable insights into Cmtr2 function and can guide experimental design for further biochemical characterization.

What are the most effective gene editing approaches for studying Cmtr2 function in vivo?

For studying Cmtr2 function in vivo, several gene editing approaches have proven effective:

  • CRISPR-Cas9 knockout/knockdown strategies:

    • Complete gene knockout to eliminate Cmtr2 expression

    • CRISPR interference (CRISPRi) for tunable repression of Cmtr2 expression

    • As demonstrated in studies of related methyltransferases, CRISPR-mediated editing can be validated by DNA sequencing and Western blot assay

  • Conditional knockout systems:

    • Cre-loxP system for tissue-specific or inducible deletion of Cmtr2

    • Tetracycline-inducible systems for temporal control of Cmtr2 expression

    • These approaches can help bypass potential embryonic lethality of complete knockout

  • Knock-in strategies for mechanistic studies:

    • Introduction of point mutations in catalytic residues (e.g., in the K-D-K catalytic triad)

    • Tagging with fluorescent proteins or affinity tags for localization and interaction studies

    • Domain-specific mutations to dissect the functional importance of different protein regions

  • In vivo models:

    • Mouse models with Cmtr2 alterations can be used to study phenotypic consequences

    • Cell line models (like 4T1 cells used for CMTR1 studies) can be employed for in vitro functional validation

  • Phenotypic assessment:

    • Assessing effects on cell growth (as seen with CMTR1 depletion dramatically inhibiting cell growth)

    • Evaluating clonal growth efficiency in soft agar as a measure of tumorigenicity

    • Analyzing gene expression changes, particularly focusing on TOP element-containing transcripts

These approaches provide complementary strategies for comprehensive analysis of Cmtr2 function in various biological contexts.

How can researchers investigate the interplay between Cmtr2 and other RNA modification enzymes?

Investigating the interplay between Cmtr2 and other RNA modification enzymes requires multi-faceted approaches:

  • Co-immunoprecipitation and proximity labeling:

    • Identify physical interactions between Cmtr2 and other RNA modification enzymes

    • BioID or APEX2 proximity labeling to map the spatial organization of RNA modification complexes

    • Analyze how these interactions change under different cellular conditions

  • Sequential enzymatic assays:

    • Test how prior RNA modifications affect Cmtr2 activity and vice versa

    • For example, examine whether m7G capping or Cmtr1-mediated first nucleotide methylation affects Cmtr2 efficiency

    • Evidence suggests Cmtr2 can methylate substrates regardless of methylation status of the cap guanosine or N1 ribose

  • Multi-omics approaches:

    • Combine transcriptomics, proteomics, and epitranscriptomics data

    • Similar to studies with CMTR1, analyze changes in RNA modification patterns and gene expression after Cmtr2 manipulation

    • Correlation analysis between different modifications can reveal cooperative or antagonistic relationships

  • Functional redundancy analysis:

    • Create single and double knockout models of Cmtr2 and other RNA modification enzymes

    • Assess whether phenotypes are exacerbated in double knockouts, suggesting non-redundant functions

    • Investigate potential compensatory mechanisms when one enzyme is depleted

  • Compartmentalization studies:

    • Examine subcellular localization of different RNA modification enzymes

    • Unlike predominantly nuclear Cmtr1, Cmtr2 is primarily cytoplasmic in mammals, suggesting different timing of action during RNA processing

These methodologies provide a comprehensive framework for understanding the complex interplay between Cmtr2 and other components of the RNA modification machinery.

What are the critical factors for designing experiments to assess the impact of Cmtr2-mediated methylation on mRNA fate?

When designing experiments to assess Cmtr2-mediated methylation effects on mRNA fate, consider these critical factors:

  • RNA substrate preparation:

    • Use tetranucleotide cap analogs for co-transcriptional capping during in vitro transcription

    • Create matched RNA pairs differing only in the methylation status of the second transcribed nucleotide

    • Consider both cap2 (methylation at first and second positions) and cap2-1 (methylation only at second position) structures

  • Cell type selection:

    • Include multiple cell types in experiments as 2'-O-methylation effects are cell-specific

    • Consider both normal and cancer cell lines to capture physiological variations

    • Include relevant primary cells when possible to avoid cell line artifacts

  • Readout parameters:

    • Measure multiple aspects of mRNA fate:

      • Stability (half-life measurements)

      • Translation efficiency (polysome profiling, ribosome profiling)

      • Subcellular localization (FISH or fractionation approaches)

      • Protein interactome changes (RNA pulldown followed by mass spectrometry)

  • Controls and normalization:

    • Include appropriate controls (unmethylated, cap0, cap1) for comparison

    • Use reporter systems with internal controls to normalize for transfection efficiency

    • Consider spike-in controls for RNA sequencing experiments

  • Time course analysis:

    • Capture both immediate and long-term effects of methylation

    • Early timepoints may reveal direct effects, while later timepoints show adaptive responses

These design considerations will help create robust experiments that accurately capture the biological impact of Cmtr2-mediated methylation.

What are common challenges in purifying active recombinant Cmtr2 and how can they be addressed?

Purifying active recombinant Cmtr2 presents several challenges that can be addressed through specific strategies:

  • Protein solubility issues:

    • Challenge: Cmtr2 may form inclusion bodies when overexpressed

    • Solution:

      • Optimize expression conditions (lower temperature, reduced IPTG)

      • Use solubility tags (MBP, SUMO, or GST)

      • Consider native purification from mammalian cells rather than bacterial systems

  • Maintaining enzymatic activity:

    • Challenge: Loss of activity during purification

    • Solution:

      • Include protease inhibitors and reducing agents in all buffers

      • Minimize purification steps and processing time

      • Add stabilizing agents (glycerol, low concentrations of substrate)

      • Ensure proper storage conditions (-80°C in small aliquots)

  • Protein heterogeneity:

    • Challenge: Multiple conformational states or post-translational modifications

    • Solution:

      • Use size exclusion chromatography to isolate homogeneous populations

      • Verify structural integrity via circular dichroism or thermal shift assays

      • Consider mass spectrometry to identify post-translational modifications

  • Co-purification of contaminants:

    • Challenge: Contaminating nucleic acids or endogenous methyltransferases

    • Solution:

      • Include benzonase treatment during lysis

      • Add high salt washes during affinity purification

      • Perform ion exchange chromatography as an additional purification step

  • Structural constraints:

    • Challenge: Recombinant proteins may have different tertiary structures compared to native protein

    • Solution:

      • Optimize construct design based on structural predictions

      • Consider expressing individual domains separately

      • Validate activity using functional assays before proceeding with experiments

Implementing these strategies can significantly improve the yield and quality of purified active Cmtr2 for experimental applications.

How can researchers troubleshoot inconsistent results in Cmtr2 methyltransferase activity assays?

When facing inconsistent results in Cmtr2 methyltransferase activity assays, consider these troubleshooting approaches:

  • Enzyme quality assessment:

    • Verify enzyme purity via SDS-PAGE and activity via pilot assays

    • Check for protein degradation using western blotting

    • Ensure proper storage conditions are maintained to preserve activity

    • The stability of enzymatic preparations can diminish over time, with loss rates potentially reaching 5% even under appropriate storage conditions

  • Substrate considerations:

    • Ensure RNA substrates have the correct cap structure (unmethylated at position 2)

    • Verify RNA integrity before assays (no degradation)

    • Consider RNA secondary structure effects on accessibility

    • Test multiple RNA sequences, as substrate specificity may exist

  • Reaction conditions optimization:

    • Systematically vary buffer components (pH, salt concentration, divalent cations)

    • Optimize temperature and incubation time

    • Ensure SAM (methyl donor) is fresh and active

    • Consider adding RNase inhibitors to prevent substrate degradation

  • Detection method validation:

    • Run positive and negative controls with each assay

    • Consider using multiple detection methods to cross-validate results

    • For quantitative assays, verify linearity of the detection method

    • Establish standard curves with known amounts of methylated product

  • Experimental standardization:

    • Maintain consistent lab conditions and procedures

    • Have the same researcher perform related experiments when possible

    • Document all experimental conditions meticulously

    • As noted in product documentation, operation procedures and lab conditions should be strictly controlled to minimize performance fluctuations

By systematically addressing these potential sources of variability, researchers can achieve more consistent and reliable results in Cmtr2 methyltransferase activity assays.

What are the unexplored aspects of Cmtr2 function in RNA metabolism and cellular signaling?

Despite progress in understanding Cmtr2, several aspects remain unexplored:

  • Substrate specificity determinants:

    • The sequence or structural preferences that determine which mRNAs receive Cmtr2-mediated methylation

    • Potential recognition of specific RNA elements beyond the cap structure

    • The model of Cmtr2 suggests that some base pair combinations in the 5' end of capped RNAs may be more easily accommodated by the enzyme active site than others

  • Regulatory mechanisms controlling Cmtr2 activity:

    • Post-translational modifications affecting Cmtr2 function

    • Environmental conditions that modulate Cmtr2 activity

    • Protein-protein interactions that direct Cmtr2 to specific substrates

  • Cross-talk with other RNA modification pathways:

    • Interaction between Cmtr2-mediated methylation and internal mRNA modifications like m6A, m5C

    • Sequential ordering of different cap modifications

    • Competition or cooperation between different RNA-modifying enzymes

  • Signaling pathway integration:

    • How cellular signaling cascades regulate Cmtr2 activity

    • Whether Cmtr2-mediated methylation responds to specific stress conditions

    • Potential role in coordinating transcriptional and translational responses

  • Evolutionary aspects:

    • Conservation and divergence of Cmtr2 function across species

    • Species-specific adaptation of Cmtr2-dependent regulatory mechanisms

    • Coevolution with viral strategies to mimic or evade host cap modifications

Investigating these unexplored aspects will provide a more comprehensive understanding of Cmtr2's role in RNA metabolism and cellular signaling.

How might Cmtr2 function be targeted or manipulated for therapeutic applications?

Potential therapeutic applications targeting Cmtr2 function include:

  • Cancer therapeutics:

    • Given the altered expression patterns of Cmtr2 in multiple cancer types, targeting its activity might offer cancer-specific interventions

    • Unlike CMTR1, which showed higher cancer dependency scores (mean -0.79), CMTR2 exhibited lower dependency (mean -0.08), suggesting potentially fewer off-target effects when modulated

    • Targeting protein upregulation mechanisms in specific cancers where Cmtr2 protein is elevated despite lower mRNA levels

  • Antiviral strategies:

    • Since 2'-O-methylation serves as a determinant for defining transcripts as "self," modulating Cmtr2 activity could potentially enhance antiviral immune responses

    • Temporary inhibition might increase immune surveillance against viral pathogens

    • Compounds that selectively block viral but not host cap methylation would be particularly valuable

  • mRNA therapeutics enhancement:

    • Optimizing cap structures in synthetic mRNAs for vaccines or gene therapy

    • Strategic methylation or demethylation of therapeutic mRNAs to enhance stability or translation in target tissues

    • Creating cell-specific effects by leveraging the cell-type dependency of Cmtr2-mediated methylation impact

  • Immunomodulation:

    • Calibrating immune responses by modifying the "self" signature on mRNAs

    • Potential applications in autoimmune diseases or enhancing cancer immunotherapy

    • Manipulating the balance between immune activation and tolerance

  • Potential therapeutic approaches:

    • Small molecule inhibitors targeting the methyltransferase active site

    • Antisense oligonucleotides for tissue-specific Cmtr2 knockdown

    • Protein degraders (PROTAC approach) for selective Cmtr2 removal

These therapeutic applications represent promising areas for translational research involving Cmtr2.

What technologies are needed to advance our understanding of the spatial and temporal dynamics of Cmtr2-mediated methylation?

Advancing our understanding of Cmtr2 spatial and temporal dynamics requires developing or adapting several key technologies:

  • Single-molecule RNA imaging techniques:

    • Methods to visualize Cmtr2-mediated methylation events in real-time

    • Techniques to track the fate of specifically methylated versus unmethylated RNAs

    • Super-resolution microscopy approaches to locate Cmtr2 within cellular compartments

  • Site-specific methylation detection methods:

    • High-throughput sequencing approaches that can precisely identify 2'-O-methylation at the second transcribed nucleotide

    • Mass spectrometry techniques with enhanced sensitivity for detecting cap modifications

    • Antibodies or chemical probes specific for cap2 structures

  • Temporally controlled modulation systems:

    • Optogenetic tools to activate or inactivate Cmtr2 with spatial and temporal precision

    • Rapidly inducible expression systems to study acute effects of Cmtr2 manipulation

    • Degrader technologies (e.g., dTAG systems) for targeted protein elimination

  • Dynamic interaction mapping:

    • Methods to capture transient interactions between Cmtr2 and its substrates or binding partners

    • Techniques to determine how these interactions change under different cellular conditions

    • Systems to track the assembly and disassembly of RNA modification complexes

  • Computational tools and models:

    • Enhanced algorithms for predicting methylation sites and consequences

    • Systems biology approaches to integrate Cmtr2 function into broader cellular networks

    • Machine learning methods to identify patterns in Cmtr2-dependent gene expression

Development and application of these technologies will provide unprecedented insights into when, where, and how Cmtr2 functions within cells, significantly advancing our understanding of this important RNA modification enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.