Recombinant Mouse FUN14 domain-containing protein 1 (Fundc1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Fundc1; FUN14 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MASRNPPPQDYESDDESYEVLDLTEYARRHHWWNRVFGHSSGPMVEKYSVATQIVMGGVT GWCAGFLFQKVGKLAATAVGGGFLLLQVASHSGYVQIDWKRVEKDVNKAKRQIKKRANKA APEINNIIEEATDFIKQNIVISSGFVGGFLLGLAS
Uniprot No.

Target Background

Function
Recombinant Mouse FUN14 domain-containing protein 1 (Fundc1) acts as an activator of hypoxia-induced mitophagy, a critical process in mitochondrial quality control.
Gene References Into Functions

Functional Studies of FUNDC1:

  1. NR4A1 disrupts mitochondrial homeostasis, enhances endothelial apoptosis, and induces microvascular dysfunction in myocardial ischemia-reperfusion injury by promoting Mff-mediated mitochondrial fission and FUNDC1-dependent mitophagy. PMID: 29744594
  2. FUNDC1 is essential for mitophagy activation during cardiac ischemia-reperfusion injury. PMID: 28732308
  3. Hypoxic preconditioning induces FUNDC1-dependent mitophagy in platelets, reducing ischemia/reperfusion-induced heart injury, suggesting a novel cardioprotective strategy. PMID: 28323531
  4. FUNDC1 interacts with IP3R2 to modulate ER Ca2+ release into mitochondria and the cytosol. Disruption of this interaction decreases mitochondrial and cytosolic Ca2+ levels, leading to aberrant mitochondrial fission, dysfunction, cardiac dysfunction, and heart failure. PMID: 28942427
  5. MicroRNA-137 inhibits mitophagy by regulating the mitophagy receptors FUNDC1 and NIX. PMID: 24573672
Database Links
Protein Families
FUN14 family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is the primary function of FUNDC1 in mitochondrial dynamics?

FUNDC1 serves as a hypoxia-induced mitophagy receptor that specifically identifies and facilitates the degradation of damaged mitochondria. Under hypoxic conditions, FUNDC1 recruits LC3 protein family members to mitochondria, enhancing selective mitophagy and reducing mitochondria-dependent apoptosis . This mechanism is particularly important in tissues with high metabolic demand, such as cardiac and neural tissues.

When designing experiments to study FUNDC1-mediated mitophagy, researchers should consider including appropriate oxygen deprivation conditions (1-5% O₂) and monitoring changes in mitochondrial markers such as TOM20 or COXIV alongside autophagy markers like LC3-II/I ratio and p62 degradation .

How can I effectively detect mouse FUNDC1 protein in experimental samples?

For reliable detection of mouse FUNDC1, western blotting using commercially available rabbit polyclonal antibodies has shown good results. These antibodies typically target the N-terminal domain (amino acids 1-50) of FUNDC1 . For immunohistochemistry on paraffin-embedded tissues (IHC-P), optimization of antigen retrieval methods is crucial, with citrate buffer (pH 6.0) heating generally providing better results than EDTA-based methods.

Standard dilutions for western blotting range from 1:1000 to 1:2000, while IHC-P applications typically require 1:100 to 1:500 dilutions. When validating antibody specificity, include appropriate positive controls (tissue with known FUNDC1 expression) and negative controls (FUNDC1 knockout samples or secondary antibody-only controls) .

What are the key structural domains of FUNDC1 that affect its function?

FUNDC1 contains three critical structural elements: an N-terminal cytoplasmic domain, a FUN14 domain, and three transmembrane segments anchoring it to the mitochondrial outer membrane . The N-terminal cytoplasmic region is particularly important as it:

  • Mediates interaction with kinesin light chain 1 (KLC1)

  • Contains the LC3-interacting region (LIR) motif necessary for mitophagy

  • Undergoes phosphorylation/dephosphorylation modifications that regulate its activity

For structure-function studies, site-directed mutagenesis of key residues in the N-terminal domain (particularly Y18 and S13) allows investigation of how phosphorylation states affect FUNDC1's interactions with partner proteins . When designing recombinant FUNDC1 constructs, researchers should carefully consider whether to include tags at the N-terminus, as these may interfere with functional interactions.

How does FUNDC1 coordinate cross-talk between mitochondria and endoplasmic reticulum in research models?

FUNDC1 serves as a crucial mediator in the formation of mitochondria-associated endoplasmic reticulum membranes (MAMs), which are specialized contact sites between these organelles . Methodologically, to study this function:

  • Use proximity ligation assays to visualize and quantify ER-mitochondria contacts

  • Employ split-GFP complementation systems where one fragment is targeted to mitochondria and the other to ER

  • Measure calcium transfer between organelles using organelle-specific calcium indicators

Research has demonstrated that FUNDC1 facilitates Ca²⁺ communication between the ER and mitochondria, which influences multiple downstream processes including VEGFR2 expression and angiogenesis . In experimental models where FUNDC1 is specifically deleted in endothelial cells, researchers observed disrupted MAM formation, reduced VEGFR2 expression, and decreased angiogenic capacity both in vitro and in vivo .

What experimental approaches best demonstrate the neuroprotective effects of FUNDC1 in spinal cord injury models?

To effectively investigate FUNDC1's neuroprotective role in spinal cord injury (SCI), a multi-faceted approach is necessary:

  • In vivo models: Use standardized rat SCI models (contusion or compression injury) with FUNDC1 overexpression or knockdown via viral vectors. Measure locomotor recovery (BBB scores), tissue sparing, and neuronal survival rates .

  • In vitro approaches: Employ oxygen-glucose deprivation (OGD) in NGF-treated PC12 cells or primary neurons to mimic ischemic conditions following SCI .

  • Mechanistic studies: Combine approaches with autophagy inhibitors (3-methyladenine) to confirm mitophagy-dependent mechanisms.

Research findings indicate that FUNDC1 overexpression significantly enhances autophagy (increased LC3B II/I ratio, decreased P62) and reduces apoptotic markers (decreased Bax, cleaved-caspase3, cleaved-caspase9; increased Bcl-2) in SCI models . These protective effects can be reversed by autophagy inhibitors, confirming the mitophagy-dependent mechanism.

How can I design experiments to investigate the role of FUNDC1 in angiogenesis and neoangiogenesis?

To study FUNDC1's role in angiogenesis, consider these methodological approaches:

  • Endothelial-specific genetic modifications: Use Cre-loxP systems with endothelial-specific promoters (Tie2-Cre or VE-cadherin-Cre) to create conditional FUNDC1 knockout or overexpression models .

  • In vitro angiogenesis assays:

    • Tube formation assays on Matrigel

    • Spheroid sprouting assays

    • Endothelial cell migration and proliferation assays

  • In vivo models:

    • Matrigel plug assays

    • Retinal angiogenesis models

    • Tumor angiogenesis models

Research has demonstrated that endothelial cell-specific deletion of FUNDC1 disrupts MAM formation, reduces VEGFR2 expression, and significantly impairs angiogenic capacity. Mechanistically, FUNDC1-mediated MAM formation increases cytosolic Ca²⁺, promoting serum response factor (SRF) phosphorylation, which enhances binding to the VEGFR2 promoter and increases VEGFR2 production .

What are the technical challenges in studying FUNDC1 interactions with kinesin motor proteins, and how can they be overcome?

Investigating FUNDC1's interactions with kinesin motor proteins presents several technical challenges:

  • Membrane protein purification: As a mitochondrial membrane protein, FUNDC1 is difficult to purify in its native conformation. Solution: Focus on the N-terminal cytoplasmic domain (amino acids 1-50) for interaction studies, as this region mediates binding to kinesin light chain 1 (KLC1) .

  • Distinguishing direct vs. indirect interactions: Use multiple complementary approaches:

    • Yeast two-hybrid screening with the KLC1 tetratricopeptide repeat (TPR) domain as bait

    • GST pull-down assays with purified proteins to confirm direct interactions

    • Co-immunoprecipitation from cell lysates to verify interactions in cellular context

  • Functional relevance assessment: Combine protein interaction studies with functional assays:

    • Live-cell imaging of mitochondrial transport

    • Analysis of mitochondrial distribution in cells expressing wild-type vs. mutant FUNDC1

Research has shown that the N-terminal cytoplasmic domain of FUNDC1 interacts with the TPR domain of KLC1 but not with KIF5B (kinesin heavy chain) or KIF3A (a motor subunit of kinesin 2). This suggests that KLC1 may compete with LC3 for binding to FUNDC1, potentially regulating the balance between mitochondrial transport and mitophagy .

How should I design controls for FUNDC1 overexpression or knockdown experiments?

Proper controls are critical for FUNDC1 manipulation studies:

  • For overexpression:

    • Empty vector control (same vector backbone without FUNDC1)

    • Overexpression of mutated, non-functional FUNDC1 (e.g., LIR motif mutant)

    • Dose-dependent expression controls to account for potential artifacts from excessive overexpression

  • For knockdown/knockout:

    • Non-targeting siRNA/shRNA controls with similar GC content

    • Rescue experiments with siRNA-resistant FUNDC1 constructs to confirm specificity

    • For CRISPR/Cas9 approaches, include multiple guide RNAs and validate with off-target analysis

  • Phenotypic validation:

    • Confirm altered FUNDC1 levels by both protein (western blot) and mRNA (qPCR) analyses

    • Verify subcellular localization remains correct in overexpression models

    • Assess basic mitochondrial parameters (mass, membrane potential, morphology) as baseline characterization

What methods can resolve conflicting data regarding FUNDC1's role in different pathological conditions?

When facing contradictory results about FUNDC1 function across different disease models, consider these methodological approaches:

  • Context-specific regulation: Systematically compare FUNDC1's effects across different:

    • Cell types (neurons, cardiomyocytes, endothelial cells)

    • Stress conditions (hypoxia, nutrient deprivation, oxidative stress)

    • Disease models (SCI, heart failure, cancer)

  • Temporal dynamics: Analyze FUNDC1 function at multiple time points:

    • Early vs. late stages of pathology

    • Acute vs. chronic stress responses

    • Recovery phases

  • Interaction network mapping: Use proteomics approaches to identify context-specific FUNDC1 binding partners:

    • BioID or APEX proximity labeling

    • Quantitative interaction proteomics under different conditions

    • Phosphorylation state-dependent interactome analysis

Research has revealed that FUNDC1 can be protective in acute neuronal injury by enhancing mitophagy and reducing apoptosis , while also playing critical roles in angiogenesis through MAM formation and Ca²⁺ signaling . Additionally, studies have linked reduced FUNDC1 in cardiomyocytes to cardiac dysfunction and heart failure . These seemingly diverse functions may reflect tissue-specific roles or different temporal aspects of FUNDC1 activity.

How can phosphorylation status of FUNDC1 be accurately assessed in experimental models?

FUNDC1's activity is regulated through phosphorylation/dephosphorylation of key residues, particularly S13 and Y18. To accurately assess these modifications:

  • Phospho-specific antibodies: Use antibodies specifically recognizing phosphorylated S13 or Y18 of FUNDC1. Validate specificity using phosphatase treatments and phospho-deficient mutants (S13A, Y18F).

  • Mass spectrometry approaches:

    • Targeted MS analysis of immunoprecipitated FUNDC1

    • Parallel Reaction Monitoring (PRM) for sensitive detection of specific phosphopeptides

    • SILAC or TMT labeling for quantitative comparison across conditions

  • Functional readouts: Correlate phosphorylation states with:

    • LC3 binding efficiency (measured by co-IP or proximity ligation assay)

    • Mitophagy rates (assessed by mt-Keima or mito-QC reporter systems)

    • Mitochondrial quality parameters (membrane potential, ROS production)

Research has shown that hypoxia induces dephosphorylation of FUNDC1 at S13, enhancing its interaction with LC3 and promoting mitophagy. Conversely, certain kinases (such as SRC, CK2) can phosphorylate FUNDC1, inhibiting its mitophagy-promoting function in normoxic conditions .

What are the most effective methods to visualize and quantify FUNDC1-mediated mitophagy in live cells?

For dynamic assessment of FUNDC1-mediated mitophagy:

  • Dual-fluorescence reporters:

    • mt-Keima: A pH-sensitive mitochondrial-targeted fluorescent protein that shifts emission spectrum when mitochondria are delivered to acidic lysosomes

    • mito-QC: Tandem mCherry-GFP tag on mitochondrial proteins; GFP signal is quenched in lysosomes while mCherry remains stable

  • Live-cell co-localization analysis:

    • Co-express fluorescently tagged FUNDC1 and LC3 to track recruitment kinetics

    • Use mitochondrially-targeted fluorescent proteins to monitor morphology changes during mitophagy

  • Quantitative analysis approaches:

    • Time-lapse microscopy with automated image analysis

    • Single-cell analysis to account for heterogeneity in mitophagy responses

    • Correlative light and electron microscopy for ultrastructural confirmation

When studying hypoxia-induced mitophagy, it's important to use environmentally controlled microscopy chambers that maintain low oxygen levels during imaging. Additionally, including pharmacological controls (CCCP/FCCP as positive controls for mitophagy, and 3-methyladenine or Bafilomycin A1 as inhibitory controls) helps validate the specificity of observed mitophagy events .

How can FUNDC1-related pathways be targeted for therapeutic development in spinal cord injury?

Based on FUNDC1's protective role in SCI, several therapeutic strategies can be explored:

  • Enhancement of FUNDC1-mediated mitophagy:

    • Develop small molecules that mimic hypoxia-induced dephosphorylation of FUNDC1

    • Design peptide-based therapeutics that stabilize FUNDC1-LC3 interactions

    • Create gene therapy approaches for transient FUNDC1 overexpression in injured spinal cord

  • Combination therapies:

    • Pair FUNDC1 pathway enhancement with anti-inflammatory treatments

    • Combine with approaches targeting secondary injury mechanisms

    • Integrate with neural stem cell therapies for comprehensive repair

  • Delivery optimization:

    • Develop nanoparticle-based delivery systems for FUNDC1-targeting compounds

    • Design time-released formulations to match the temporal profile of SCI pathology

    • Use cell-penetrating peptides to enhance delivery across the blood-spinal cord barrier

Research findings demonstrate that FUNDC1 overexpression enhances neuronal autophagy, decreases apoptosis, inhibits mitochondria-dependent apoptosis, and improves mitochondrial function in SCI models . The protective effects were reversed by autophagy inhibition, confirming the mitophagy-dependent mechanism. These results suggest that early activation of FUNDC1 could serve as a therapeutic target for SCI treatment.

How might FUNDC1's role in angiogenesis be leveraged in cardiovascular research applications?

FUNDC1's involvement in angiogenesis and cardiac function offers several research directions:

  • Pro-angiogenic applications:

    • For ischemic heart disease, develop approaches to enhance FUNDC1-mediated MAM formation in endothelial cells

    • Design peptide mimetics of FUNDC1 domains that promote MAM formation and Ca²⁺ signaling

    • Create conditional expression systems for localized FUNDC1 upregulation in ischemic tissues

  • Anti-angiogenic strategies:

    • For tumor angiogenesis, develop cell-penetrating inhibitory peptides targeting FUNDC1-dependent MAM formation

    • Screen for compounds that disrupt FUNDC1's interaction with ER-mitochondria tethering proteins

    • Design endothelial-specific FUNDC1 inhibitors for cancer therapy

  • Cardiac protection approaches:

    • Target FUNDC1 pathways in cardiomyocytes to enhance mitochondrial quality control

    • Develop interventions that maintain optimal FUNDC1 levels to prevent heart failure progression

    • Create diagnostic tools to monitor FUNDC1 activity as a biomarker for cardiac mitochondrial health

Research has shown that FUNDC1-dependent MAM formation significantly impacts angiogenesis through regulation of VEGFR2 expression . Additionally, reducing FUNDC1 in cardiac muscle cells initiates cardiac dysfunction and heart failure . These findings suggest that FUNDC1-targeted approaches could provide novel therapeutic strategies for both promoting beneficial angiogenesis in ischemic conditions and protecting cardiac function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.