Recombinant Mouse G protein-activated inward rectifier potassium channel 3 (Kcnj9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Kcnj9; Girk3; G protein-activated inward rectifier potassium channel 3; GIRK-3; Inward rectifier K(+ channel Kir3.3; Potassium channel, inwardly rectifying subfamily J member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAQENAAFSPGSEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK VEEEGAGEGAGAGDGADKEHNGCLPPPESESKV
Uniprot No.

Target Background

Function
This G protein-regulated receptor belongs to the inward rectifier potassium channel family. These channels exhibit a preference for potassium influx over efflux. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel activation voltage to more positive potentials. Inward rectification primarily results from magnesium-mediated blockage of outward current.
Gene References Into Functions
  • GIRK-3 knockout mice demonstrate enhanced ethanol conditioned place preference and reward compared to wild-type controls. PMID: 27012303
  • GIRK3 appears crucial in mediating ethanol incentive salience and may be a therapeutic target for excessive alcohol consumption. PMID: 25964320
  • GIRK3 plays a critical role in NCAM-dependent neurite outgrowth, highlighting a functional interplay between Kir3.3, NCAM, and TrkB during development. PMID: 20610389
  • GIRK3 expression is observed in Purkinje neurons, basket cells, stellate cells, and unipolar brush cells. PMID: 18088366
  • Genetic variation within the Kcnj9 gene is implicated in mediating pain inhibition and individual responses to analgesic drugs. PMID: 18300945
  • Kcnj9 knockout mice exhibit attenuated withdrawal symptoms from pentobarbital and other sedative-hypnotics. PMID: 19759313
Database Links
Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ9 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed mainly in the brain, some expression in the skeletal muscle.

Q&A

What is the KCNJ9 gene and what protein does it encode?

The KCNJ9 gene encodes the G protein-activated inward rectifier potassium channel 3 (GIRK3, also known as KIR3.3), which is an integral membrane protein functioning as an inward-rectifier type potassium channel. This protein has a greater tendency to allow potassium to flow into a cell rather than out and is controlled by G-proteins . In research applications, recombinant mouse KCNJ9 provides a valuable model for studying channel function, as the protein's structure and function are highly conserved between species while allowing for specific experimental manipulations.

How does KCNJ9/GIRK3 function in cellular physiology?

KCNJ9/GIRK3 functions as part of heteromultimeric pore-forming complexes with other G-protein-activated potassium channels. It participates in a wide range of physiological responses by regulating potassium conductance across cell membranes . The channel is primarily activated through the binding of G protein βγ subunits, which are released when G protein-coupled receptors are stimulated. This activation mechanism allows GIRK channels to respond to various neurotransmitters and neuromodulators, thereby influencing neuronal excitability, heart rate, and other physiological processes.

What protein interactions are important for KCNJ9 function?

KCNJ9 has been shown to interact with KCNJ6 (GIRK2) to form functional heteromultimeric channel complexes . Research has demonstrated that G protein βγ subunits, particularly those containing β1, β3, or β4 with various γ subunits, can bind directly to cytoplasmic domains of GIRK channel proteins and activate the channels . These interactions are critical for channel function and regulation. Notably, while β1, β3, and β4-containing dimers activate GIRK channels, β5-containing dimers have been shown to inhibit GIRK channel currents, suggesting a complex regulatory mechanism .

What are optimal expression systems for recombinant mouse KCNJ9 studies?

For recombinant mouse KCNJ9 studies, several expression systems have proven effective:

  • Cell Line Transfection: Mammalian cell lines such as HEK293 cells can be transiently transfected with expression vectors containing the mouse KCNJ9 gene. This approach is particularly valuable for electrophysiological studies, as demonstrated in research examining GIRK channel activation by various G protein βγ subunits .

  • Stable Cell Lines: Developing stable cell lines expressing mouse KCNJ9 either alone or with other GIRK subunits provides consistent experimental conditions for long-term studies.

  • Primary Neuronal Cultures: For more physiologically relevant contexts, mouse primary neuronal cultures with transfected or virally delivered KCNJ9 constructs can be utilized.

The selection of an appropriate expression system should be guided by specific experimental objectives, required protein yields, and the need for post-translational modifications.

What electrophysiological techniques are most appropriate for studying recombinant mouse KCNJ9 function?

Several electrophysiological approaches are effective for studying mouse KCNJ9 channel properties:

  • Whole-Cell Patch Clamp: This technique allows measurement of macroscopic currents through GIRK channels in intact cells. It is particularly useful for studying receptor-mediated activation of channels and for pharmacological characterization.

  • Inside-Out Patch Configuration: This approach enables direct application of purified G protein subunits to the cytoplasmic face of the membrane, allowing precise control over channel activation conditions.

  • Two-Electrode Voltage Clamp: When using Xenopus oocytes as an expression system, this technique can be employed to study channel properties.

When conducting electrophysiological experiments with KCNJ9, it's important to include appropriate controls and to consider the heteromeric nature of functional GIRK channels, as GIRK3 typically forms heteromers with other GIRK subunits such as GIRK2/KCNJ6 .

How can protein-protein interactions involving KCNJ9 be effectively studied?

Multiple complementary approaches can be employed to study KCNJ9 protein interactions:

  • Biochemical Pull-Down Assays: GST-fusion proteins containing N- and C-terminal cytoplasmic domains of GIRK channels can be used to detect direct binding of G protein subunits or other interacting proteins. This technique has successfully demonstrated that purified, recombinant β3γ2 and β4γ2 dimers bind directly to GIRK channel cytoplasmic domains .

  • Co-Immunoprecipitation: This method can identify native protein complexes containing KCNJ9 in cellular systems or tissues.

  • FRET/BRET Techniques: These approaches allow real-time monitoring of protein interactions in living cells and can reveal dynamic aspects of KCNJ9 interactions.

  • Yeast Two-Hybrid Screening: Though this method has limitations (some interactions, like those between β3/β4 and GIRK1, were not detected in yeast two-hybrid assays despite functional evidence ), it can serve as an initial screen for potential interacting partners.

How do G protein βγ subunits differentially regulate KCNJ9-containing channels?

G protein βγ subunits exhibit diverse regulatory effects on KCNJ9-containing channels, creating a complex system of channel modulation:

G Protein SubunitEffect on GIRK ChannelsBinding to GIRK DomainsMechanism
β1γ2ActivationBinds N- and C-terminiDirect binding promotes channel opening
β3γ2ActivationBinds N- and C-terminiDirect binding promotes channel opening
β4γ2ActivationBinds N- and C-terminiDirect binding promotes channel opening
β5γ2InhibitionBinds same domains as activating dimersPossibly acts as competitive antagonist
β5γ11InhibitionNot specifically testedSimilar mechanism as β5γ2

Research has demonstrated that β3 and β4-containing dimers, like β1-containing dimers, can bind to both N- and C-terminal cytoplasmic domains of GIRK channels and activate them. In contrast, β5-containing dimers inhibit GIRK channel currents in a dose-dependent manner consistent with competitive inhibition. This inhibitory effect is observed with either β5γ2 or β5γ11 and affects both basal and agonist-induced currents .

What approaches can be used to study KCNJ9 channel gating mechanisms?

Several methodological approaches are valuable for investigating the gating mechanisms of KCNJ9-containing channels:

  • Site-Directed Mutagenesis: Creating specific mutations in key channel regions can help identify amino acids critical for channel gating, G protein interactions, or ion selectivity.

  • Chimeric Channel Construction: Generating chimeric channels with segments from different GIRK subunits can help identify domains responsible for specific functional properties.

  • Structural Modeling: When direct structural data is unavailable, homology modeling using related proteins with known structures can provide insights into channel function. This approach was used to predict the impact of the p.Phe326Ser variant in human KCNJ9, suggesting that this mutation might disrupt hydrophobic contacts crucial for proper channel assembly .

  • Single-Channel Recording: This technique allows detailed analysis of channel kinetics, including open probability, open duration, and conductance states under various conditions.

How can disease-associated variants in KCNJ9 be functionally characterized?

A systematic approach to characterizing disease-associated KCNJ9 variants includes:

  • In Silico Analysis: Employing pathogenicity predictors such as PolyPhen-2, Sift, CADD, and REVEL to assess potential functional impacts of variants. The p.Phe326Ser variant in human KCNJ9, for example, was classified as likely pathogenic with scores of PolyPhen-2: 0.653, Sift: 0.0, CADD: 26.3, and REVEL: 0.632 .

  • Three-Dimensional Modeling: Using structural prediction tools like AlphaFold or homology modeling to understand how variants might affect protein structure and function. For the p.Phe326Ser variant, modeling suggested disruption of hydrophobic contacts that could destabilize neighboring structures and potentially impair GIRK2/GIRK3 tetramer formation .

  • Electrophysiological Assessment: Comparing wild-type and variant channels using patch-clamp techniques to evaluate potential alterations in channel function, including conductance, open probability, and response to modulators.

  • Trafficking Studies: Using fluorescently tagged constructs to assess whether variants affect channel assembly, trafficking to the membrane, or localization patterns.

  • Animal Models: Generating knock-in mouse models expressing identified variants to examine phenotypic consequences and relate them to human disease presentations.

How can recombinant mouse KCNJ9 be used to study epilepsy mechanisms?

Recent evidence suggests KCNJ9 may play a role in epilepsy, as highlighted by a case report of a de novo variant (p.Phe326Ser) in the human KCNJ9 gene associated with neonatal seizures . Researchers can leverage recombinant mouse KCNJ9 to investigate epilepsy mechanisms through several approaches:

  • Electrophysiological Studies in Brain Slices: Comparing neuronal excitability in brain slices from wild-type mice versus those with KCNJ9 mutations or altered expression.

  • Pharmacological Manipulation: Testing how compounds that modulate GIRK channels affect seizure susceptibility in mouse models.

  • Circuit-Level Analysis: Using optogenetic techniques in combination with KCNJ9 manipulation to understand how altered channel function affects neural circuit activity.

  • Knock-In Mouse Models: Creating mice with specific KCNJ9 mutations identified in human patients to determine if they recapitulate seizure phenotypes and to study underlying mechanisms.

  • Therapeutic Testing: Evaluating potential treatments that could restore normal GIRK channel function in the context of pathogenic KCNJ9 variants.

What challenges exist in distinguishing the specific roles of KCNJ9/GIRK3 from other GIRK channel subunits?

Several methodological challenges complicate efforts to dissect the specific contributions of KCNJ9/GIRK3:

  • Heteromeric Assembly: GIRK3 predominantly forms heteromeric channels with other GIRK subunits, making it difficult to isolate its specific contributions. Researchers may address this by using reconstituted systems with defined subunit compositions.

  • Subunit-Specific Antibodies: Developing and validating highly specific antibodies that can distinguish between GIRK3 and other closely related subunits is essential for accurate localization and protein interaction studies.

  • Conditional Knock-Out Models: Creating conditional, cell-type-specific knockout models can help overcome developmental compensation that may occur in conventional knockout models.

  • Subunit-Selective Pharmacology: The development of compounds that selectively target GIRK3-containing channels would greatly facilitate functional studies, but such agents remain limited.

  • Single-Cell Analysis: Employing single-cell transcriptomics and proteomics to characterize the expression patterns of different GIRK subunits across cell types can provide context for functional studies.

How can genomic approaches enhance understanding of KCNJ9's role in neurological disorders?

Genomic technologies offer powerful approaches to elucidate KCNJ9's contributions to neurological conditions:

  • Trio Whole Exome Sequencing: This approach has proven valuable in identifying de novo variants in KCNJ9, as demonstrated in a case where trio sequencing revealed a novel variant potentially linked to neonatal seizures .

  • Gene Burden Analysis: Analyzing large cohorts of patients with specific neurological phenotypes (e.g., epilepsy, pain disorders) for an increased burden of rare variants in KCNJ9 compared to controls.

  • Genotype-Phenotype Correlations: Systematically cataloging the clinical features associated with different KCNJ9 variants to identify potential genotype-phenotype relationships.

  • Functional Genomics: Using CRISPR-based approaches to introduce specific variants into cellular models and assess their functional consequences through electrophysiological and biochemical assays.

  • Multi-Omics Integration: Combining genomic findings with transcriptomic, proteomic, and electrophysiological data to build comprehensive models of how KCNJ9 variants impact neuronal function and contribute to disease states.

What are the most promising areas for future research on recombinant mouse KCNJ9?

Several research directions hold particular promise for advancing understanding of KCNJ9 function and therapeutic applications:

  • Structure-Function Relationships: Determining the high-resolution structure of GIRK3-containing channels would provide crucial insights into their function and regulation.

  • Cell-Type Specific Roles: Investigating how KCNJ9 function varies across different neuronal populations and how this contributes to circuit-level properties.

  • Disease Mechanism Elucidation: Further characterizing the role of KCNJ9 variants in neurological disorders, particularly epilepsy, could identify new therapeutic targets.

  • Pharmacological Modulators: Developing compounds that selectively target GIRK3-containing channels could provide valuable research tools and potential therapeutic agents.

  • Signaling Network Integration: Understanding how KCNJ9 function integrates with other signaling pathways, particularly those involving G protein-coupled receptors that modulate neuronal excitability.

  • Therapeutic Gene Editing: Exploring the potential of gene editing approaches to correct pathogenic KCNJ9 variants in preclinical models of neurological disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.