Recombinant Mouse G-protein coupled receptor 143 (Gpr143)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Mouse Gpr143

Mouse G-protein coupled receptor 143 (Gpr143) belongs to an enigmatic class of receptors that has not been definitively assigned to any of the traditional GPCR families due to its lack of common structural motifs . This receptor is a conserved integral membrane protein featuring seven transmembrane domains, showing similarities with other G protein-coupled receptors . The corresponding gene is regulated by the Microphthalmia-associated transcription factor (MITF), a critical regulator of melanocyte development and function . Unlike most GPCRs that operate at the cell surface, Gpr143 is uniquely positioned as an intracellular receptor, primarily localized to melanosomes in pigment-producing cells . This atypical localization contributes to its specialized functions in melanosome biogenesis and organelle size regulation in pigment cells .

Expression and Localization Patterns

While Gpr143 is most abundantly expressed in pigment-producing cells including melanocytes and retinal pigment epithelium (RPE), its expression extends beyond these tissues . In mouse models, Gpr143 has been detected in the central nervous system and certain peripheral tissues including kidney, spleen, and lung . This broader expression pattern suggests functional roles that may extend beyond pigmentation.

In pigment cells, Gpr143 predominantly localizes to the membrane of melanosomes, specialized organelles where melanin synthesis occurs . This localization is critical for its function in regulating melanosome biogenesis and size. The intracellular sorting and trafficking of Gpr143 involves the endosomal sorting complexes required for transport (ESCRT) machinery, which plays a role in receptor ubiquitination and degradation . The ESCRT complex components appear to mediate a balance between Gpr143 downregulation and delivery to melanosomes, with alterations in ESCRT subunit levels affecting receptor degradation and retention in the endosomal system .

Melanosome Biogenesis and Size Regulation

One of the primary functions of mouse Gpr143 is the regulation of melanosome biogenesis and organelle size in pigment cells . Loss of functional Gpr143 in mouse models results in the formation of abnormally large melanosomes (macromelanosomes), indicating its role in controlling organelle dimensions . Additionally, Gpr143 deficiency leads to a reduction in melanosome number and alterations in melanosome motility in both epidermal melanocytes and retinal pigment epithelium .

Signaling Pathways and Molecular Interactions

Gpr143 functions through interactions with heterotrimeric G proteins to activate intracellular signaling cascades . The receptor has been shown to interact with GNAI1 (G protein subunit alpha i1) , suggesting involvement in inhibitory signaling pathways that reduce cyclic AMP (cAMP) levels. Additionally, Gpr143 interacts with β-arrestin, which has been utilized in screening assays to identify potential ligands and chemical modulators of the receptor .

Research on Oa1-deficient mice has identified 51 differentially expressed genes, with Gpr143 and four other genes known to be associated with cAMP-signaling pathways . Analysis of these expression patterns has identified CREB (cAMP response element-binding protein) as a key transcription factor in this network , suggesting that Gpr143 signaling influences gene expression through cAMP-dependent mechanisms.

Transcriptional Regulation of Melanosomal Genes

Mouse Gpr143 regulates the transcription of melanosomal genes, including tyrosinase, the enzyme that catalyzes several reactions during melanin synthesis . This regulation occurs through modulation of the Microphthalmia-associated transcription factor (MITF), creating a feedback loop where Gpr143 acts as both an MITF regulator and target . This relationship is critical for coordinating melanin synthesis and melanosome development.

Vesicular Trafficking and Protein Delivery

Emerging evidence suggests that Gpr143 may ensure the delivery of melanosome-resident proteins (MRPs) to melanosomes rather than lysosomes by regulating multivesicular body (MVB) fusion . Exogenous Gpr143 expression has been observed to inhibit MVB-lysosome fusion, potentially allowing preferential delivery of proteins to melanosomes in pigment cells . This function may explain why Gpr143 mutations have more severe consequences in the eyes than in the skin, as lysosomal activity is crucial in retinal pigment epithelium for degradation of rod outer segments .

Recombinant Mouse Gpr143 in Research Applications

Recombinant mouse Gpr143 has become an essential tool for studying the receptor's structure, function, and potential therapeutic applications. Commercial sources provide partial recombinant mouse Gpr143 proteins (such as MBS7111736 from MyBioSource.com) for research purposes . These recombinant proteins enable investigations into binding properties, functional assays, and antibody development.

Experimental Models and Assays

Researchers have developed several experimental systems to study mouse Gpr143 function. One notable approach involves a β-arrestin recruitment assay used for screening compounds that modulate Gpr143 activity . Because wild-type Gpr143 is localized intracellularly, limiting access to potential extracellular ligands, researchers have utilized a mutant receptor that traffics to the plasma membrane while maintaining similar basal activity as the wild type . This plasma membrane-targeted version (pm-Gpr143) has the putative binding site facing the extracellular space, making it accessible to ligands in the culture medium and facilitating high-throughput screening of compound libraries .

Both wild-type Gpr143 and the plasma membrane-targeted mutant show high basal activity compared to untransfected cells, confirming that the mutations affecting localization do not interfere with receptor signaling capacity . This experimental system has proven valuable for identifying potential Gpr143 ligands and chemical modulators that could serve as pharmacological tools.

Pathological Implications of Gpr143 Dysfunction

Mouse models with Gpr143 deficiency (Oa1-/- mice) have provided significant insights into the pathological consequences of receptor dysfunction. Studies of these models have revealed that Gpr143 absence leads to reduced binocular vision through hyperproliferation-associated blocks in differentiation that impair visual system development .

  1. Presence of giant melanosomes (macromelanosomes)

  2. Reduction in melanosome number

  3. Alteration of melanosome motility

These findings parallel observations in human X-linked Ocular Albinism Type 1 (OA1), caused by mutations in the human GPR143 gene. In humans, this condition is characterized by hypopigmentation of the eyes and loss of visual acuity due to disrupted visual system development and function .

Ligands and Pharmacological Modulators

The search for endogenous and synthetic ligands of Gpr143 has yielded several candidates. L-DOPA (levodopa) and dopamine have been proposed as potential endogenous ligands for Gpr143, though they bind at relatively high concentrations . This suggests that these molecules may play physiological roles in regulating Gpr143 activity, particularly in melanosomes where L-DOPA is produced during melanin synthesis.

Through pharmacological screening approaches, researchers have identified synthetic compounds that modulate Gpr143 activity. Notably, pimozide has been identified as a Gpr143 inhibitor and may serve as a lead structure for developing more potent compounds . Such pharmacological tools contribute significantly to understanding Gpr143 function and provide platforms for designing novel therapeutic agents that could potentially address conditions related to Gpr143 dysfunction.

Future Research Directions

Research on recombinant mouse Gpr143 continues to evolve, with several promising directions for future investigation:

  1. Further structural characterization of the receptor, including crystallographic studies to elucidate binding domains and interaction interfaces

  2. Development of more potent and selective pharmacological modulators

  3. Exploration of additional physiological roles beyond pigmentation, including potential functions in cancer biology, blood pressure regulation, macular degeneration, and neural signaling

  4. Investigation of the receptor's potential as a therapeutic target for ocular albinism and related disorders

  5. Elucidation of the complete signaling network downstream of Gpr143 activation

The continued development and characterization of recombinant mouse Gpr143 will facilitate these research endeavors, potentially leading to novel therapeutic approaches for pigmentation disorders and visual system abnormalities.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gpr143; Oa1; G-protein coupled receptor 143; MOA1; Ocular albinism type 1 protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-405
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Gpr143
Target Protein Sequence
MASPRLGIFCCPTWDAATQLVLSFQPRVFHALCLGSGTLRLVLGLLQLLSGRRSVGHRAP ATSPAASVHILRAATACDLLGCLGIVIRSTVWIAYPEFIENISNVNATDIWPATFCVGSA MWIQLLYSACFWWLFCYAVDVYLVIRRSAGRSTILLYHIMAWGLAVLLCVEGAVMLYYPS VSRCERGLDHAIPHYVTTYLPLLLVLVANPILFHKTVTSVASLLKGRKGVYTENERLMGA VIKTRFFKIMLVLIACWLSNIINESLLFYLEMQPDIHGGSLKRIQNAARTTWFIMGILNP AQGLLLSLAFYGWTGCSLDVHPPKMVIQWETMTASAAEGTYQTPVRSCVPHQNPRKVVCV GGHTSDEVLSILSEDSDASTVEIHTATGSCNIKEVDSISQAQGEL
Uniprot No.

Target Background

Function
GPR143 functions as a receptor for tyrosine, L-DOPA, and dopamine. Following binding to L-DOPA, it stimulates Ca(2+) influx into the cytoplasm, enhances the secretion of the neurotrophic factor SERPINF1, and relocalizes beta arrestin at the plasma membrane. This ligand-dependent signaling occurs through a G(q)-mediated pathway in melanocytic cells. Its activity is mediated by G proteins that activate the phosphoinositide signaling pathway. GPR143 also plays a role as an intracellular G protein-coupled receptor involved in melanosome biogenesis, organization, and transport.
Gene References Into Functions
  1. Immunohistochemical analyses revealed OA1 expression in both neuronal and non-neuronal tissues. These findings suggest that OA1 may modulate monoaminergic functions in both peripheral and central nervous systems. PMID: 25601010
  2. Melanosome-autonomous regulation of size and number: the OA1 receptor sustains PMEL expression. PMID: 24650003
  3. Research has identified the Oa1 transducer Galphai3 as the first downstream component in the Oa1 signaling pathway. PMID: 21931697
  4. OA1 interacts with MART-1 at early stages of melanogenesis to control melanosome identity and composition. PMID: 19717472
  5. Asparagine at amino acid 106 is critical for N-glycosylation of the Oa1 protein. Mutation at amino acid 106 that eliminated glycosylation did not affect the endo/lysosomal distribution of Oa1 protein in cells. PMID: 11775061
  6. The expression of the ocular albinism type 1 gene is regulated by microphthalmia transcription factor (Mitf). PMID: 15254223
  7. Findings indicate that Oa1 participates in the regulation of melanosome maturation at two steps. Oa1 controls the abundance of melanosomes in RPE cells and has a function in maintaining the correct melanosomal size. PMID: 16303920
  8. Similar to Oa1, G alpha i3 plays a significant role in melanosome biogenesis. The shared Oa1-G alpha i3 signaling pathway may ultimately impact axonal growth through the optic chiasm. PMID: 18378571
  9. Data points to defective regulation of organelle transport in pigment cells in the absence of OA1. Results illuminate a novel function for OA1 in pigment cells and suggest that ocular albinism type 1 may arise from a different mechanism than previously thought. PMID: 18697795

Show More

Hide All

Database Links

KEGG: mmu:18241

STRING: 10090.ENSMUSP00000026383

UniGene: Mm.5157

Protein Families
G-protein coupled receptor OA family
Subcellular Location
Melanosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.

Q&A

What is GPR143 and why is it significant in research?

GPR143 is an atypical G protein-coupled receptor encoded by the ocular albinism 1 (OA1) gene. Unlike most GPCRs that localize to the plasma membrane, GPR143 is predominantly found intracellularly in endolysosomes and melanosomes. This receptor is significant because it plays critical roles in melanosome biogenesis and organization, and mutations in GPR143 cause X-linked Ocular Albinism Type 1 (OA1), resulting in hypopigmentation of the eyes and visual system abnormalities . From a research perspective, GPR143 represents one of the relatively rare intracellular GPCRs, offering insights into non-canonical GPCR signaling pathways and organelle regulation mechanisms .

What are the structural characteristics of GPR143 that make it unique among GPCRs?

GPR143 has not been assigned to any specific GPCR family due to its lack of common structural motifs found in canonical GPCRs. When examining the protein sequence against established GPCR motifs using the Ballesteros and Weinstein nomenclature:

These structural differences likely contribute to GPR143's atypical localization and function, making it an interesting subject for structure-function relationship studies in GPCR research .

What expression systems are optimal for producing recombinant mouse GPR143?

The choice of expression system significantly impacts protein yield, post-translational modifications, and functionality of recombinant mouse GPR143. Based on available research data, the following systems have been successfully employed:

Expression SystemAdvantagesApplicationsProtein YieldPurity
HEK-293 CellsMammalian post-translational modifications, proper foldingWestern Blot, ELISA, functional assaysHigh (≈1 mg)>90% by Bis-Tris PAGE, Western Blot, and analytical SEC (HPLC)
Cell-free protein synthesis (CFPS)Rapid production, avoids cellular toxicityStructural studies, binding assaysModerate (≈250 μg)High, without cellular contaminants
Wheat germCost-effective, good for toxic proteinsWestern Blot, ELISA, AP, AALower (10-25 μg)Varies

For functional studies examining GPR143's intracellular signaling, the HEK-293 expression system is often preferred as it provides proper mammalian post-translational modifications essential for receptor activity .

How can researchers create a plasma membrane-localized version of GPR143 for ligand screening?

To overcome the challenge of GPR143's intracellular localization in ligand screening assays, researchers can generate a plasma membrane-targeted mutant by:

  • Introducing specific mutations in the receptor's sorting signals: L223A-L224A (dileucine motif in ICL3) and W329A-E330A (tryptophan-glutamic acid doublet in C-terminal tail) .

  • Validating plasma membrane localization through immunofluorescence microscopy using epitope tags.

  • Confirming that the mutant retains functional activity comparable to wild-type GPR143 despite altered localization.

This approach has been successfully employed in β-arrestin recruitment assays, where researchers have demonstrated that the plasma membrane-localized mutant (pm-GPR143) maintains signaling capabilities similar to the wild-type receptor while providing better accessibility to potential ligands in the culture medium . This methodology enables high-throughput screening of compound libraries to identify modulators that would otherwise have limited access to the intracellularly-localized wild-type receptor .

What assays are most effective for measuring GPR143 activity in experimental settings?

Several complementary approaches can be employed to assess GPR143 activity:

  • β-arrestin recruitment assays: These have been successfully implemented for high-throughput screening of GPR143 modulators. The methodology involves:

    • Transfection of CHO β-arrestin cells with wild-type or plasma membrane-localized GPR143

    • Exposure to test compounds (typically at 10 μM with 1% DMSO final concentration)

    • Detection of β-arrestin recruitment via chemiluminescence after 90-minute incubation

  • Melanosome size and pigmentation assays: As GPR143 regulates melanosome biogenesis:

    • Treatment of melanocytes with potential GPR143 modulators

    • Quantification of changes in melanin content via spectrophotometry

    • Analysis of melanosome morphology and size via electron microscopy

  • G-protein activation assays: To assess downstream signaling:

    • [35S]GTPγS binding assays to measure G-protein activation

    • Calcium mobilization assays

    • Measurement of cAMP levels to detect coupling to different G-protein subtypes

The choice of assay depends on the specific research question, with β-arrestin recruitment providing a robust screening platform, while melanocyte-based assays offer more physiologically relevant insights into GPR143 function .

How can researchers investigate GPR143's role in intracellular trafficking pathways?

To elucidate GPR143's function in intracellular trafficking:

  • ESCRT machinery manipulation: Since GPR143 sorting and ubiquitination depend on endosomal sorting complexes required for transport (ESCRT):

    • Deploy siRNA-mediated depletion of ESCRT-0, -I, and -III subunits

    • Evaluate effects on GPR143 degradation and retention in the endosomal system

    • Assess changes in receptor ubiquitination patterns

  • Live-cell imaging of protein trafficking:

    • Generate fluorescently-tagged GPR143 constructs

    • Implement pulse-chase experiments with lysosomal and melanosomal markers

    • Analyze co-localization dynamics over time using confocal microscopy

  • Proximity labeling approaches:

    • Employ BioID or APEX2 fusion constructs with GPR143

    • Identify proximal proteins within the trafficking machinery

    • Validate interactions through co-immunoprecipitation and functional assays

Such approaches can reveal how GPR143 navigates between degradation pathways and melanosomal delivery, providing insights into the regulatory mechanisms controlling its intracellular distribution and function .

What strategies can be employed to identify endogenous ligands of GPR143?

Despite being classified as an orphan GPCR, several methodologies can be applied to identify potential endogenous ligands for GPR143:

  • Untargeted metabolomics of melanosomes:

    • Isolate melanosomes from pigmented cells

    • Perform liquid chromatography-mass spectrometry analysis

    • Identify small molecules enriched in melanosomes that may interact with GPR143

  • Displacement binding assays:

    • Utilize identified synthetic ligands as radioactive or fluorescent probes

    • Screen cellular extracts for molecules that compete for binding

    • Fractionate active extracts to isolate specific components

  • Activity-guided fractionation:

    • Prepare extracts from tissues with high GPR143 expression

    • Test fractions in β-arrestin recruitment assays with pm-GPR143

    • Progressively purify active fractions to isolate candidate ligands

  • Computational ligand prediction:

    • Generate homology models of GPR143's binding pocket

    • Perform in silico screening of endogenous metabolite libraries

    • Validate top candidates through functional assays

These complementary approaches may help deorphanize GPR143, potentially uncovering new signaling pathways relevant to pigmentation disorders and other associated pathologies .

How does GPR143 interact with other melanogenesis-associated proteins?

GPR143 has been described as a promiscuous receptor that interacts with multiple melanosomal proteins and other GPCRs, suggesting complex regulatory networks. To investigate these interactions:

  • Protein-protein interaction screens:

    • Implement membrane yeast two-hybrid systems

    • Perform co-immunoprecipitation followed by mass spectrometry

    • Use proximity labeling techniques (BioID, APEX2) to identify the GPR143 interactome in melanocytes

  • Functional genomics approaches:

    • Conduct CRISPR screens to identify genetic modifiers of GPR143 activity

    • Analyze epistatic relationships through combinatorial knockdown/overexpression studies

    • Assess melanosome morphology and pigmentation as phenotypic readouts

  • Receptor heteromerization studies:

    • Employ bioluminescence/fluorescence resonance energy transfer (BRET/FRET)

    • Investigate potential interactions with other GPCRs involved in pigmentation

    • Determine how heteromerization affects signaling outcomes

Understanding these protein networks is critical for elucidating GPR143's broader physiological roles beyond melanogenesis, including potential functions in cancer progression, blood pressure regulation, and neuronal signaling .

How can researchers address the challenge of GPR143's constitutive activity in experimental settings?

GPR143 exhibits constitutive activity that can complicate the interpretation of experimental results, particularly in ligand identification studies. To address this challenge:

  • Establish robust baseline measurements:

    • Include multiple negative controls in each experiment

    • Normalize all measurements to unstimulated receptor activity

    • Consider using inducible expression systems to control receptor levels

  • Employ inverse agonists as tools:

    • The three compounds identified in previous studies that decrease constitutive GPR143 activity can serve as experimental controls

    • Use these compounds to establish a "fully inhibited" state of the receptor

    • Calculate compound efficacy relative to these reference modulators

  • Implement appropriate statistical analyses:

    • Account for day-to-day variability in constitutive activity levels

    • Use area under the curve measurements for time-course experiments

    • Apply multiparametric analysis to distinguish true modulators from assay artifacts

These approaches can improve signal-to-noise ratios and facilitate the identification of subtle but physiologically relevant changes in GPR143 activity .

What are the potential pitfalls when comparing wild-type and plasma membrane-localized GPR143 mutants?

When utilizing plasma membrane-localized GPR143 mutants (pm-GPR143) as research tools, several important considerations should be addressed:

  • Differences in microenvironment:

    • Wild-type GPR143 functions in an acidic melanosomal/lysosomal environment

    • pm-GPR143 experiences neutral extracellular pH and different lipid composition

    • These differences may affect ligand binding properties and signaling outcomes

  • Altered protein interactions:

    • pm-GPR143 may lose access to intracellular interaction partners

    • Novel plasma membrane-associated proteins may create artifactual interactions

    • Perform comparative interactome analyses to identify location-dependent interactions

  • Data interpretation challenges:

    • Compounds active against pm-GPR143 may not reach wild-type receptors due to cell permeability issues

    • Signaling kinetics may differ between the two receptor populations

    • Always validate findings from pm-GPR143 assays with wild-type receptor when possible

What emerging technologies could advance our understanding of GPR143 function?

Several cutting-edge technologies hold promise for unraveling the complex biology of GPR143:

  • Cryo-electron microscopy:

    • Determination of GPR143's three-dimensional structure

    • Visualization of conformational changes upon activation

    • Identification of binding sites for potential ligands and interaction partners

  • Organoid and induced pluripotent stem cell (iPSC) models:

    • Development of patient-derived pigmented organoids with GPR143 mutations

    • Investigation of GPR143 function in physiologically relevant cellular contexts

    • High-throughput phenotypic screening in disease-relevant models

  • Advanced gene editing approaches:

    • Implementation of base editing to introduce specific point mutations

    • Development of conditional knockout models to study tissue-specific functions

    • Creation of knock-in reporter systems to monitor GPR143 activity in vivo

  • Novel imaging technologies:

    • Super-resolution microscopy to visualize GPR143 trafficking in real-time

    • Correlation of structural and functional imaging to link receptor localization with activity

    • Multiplexed imaging to simultaneously track multiple components of GPR143-associated pathways

These technologies could provide unprecedented insights into GPR143 biology, potentially uncovering novel therapeutic approaches for pigmentation disorders and other conditions linked to GPR143 dysfunction .

How might research on GPR143 contribute to understanding broader disease mechanisms beyond pigmentation disorders?

Emerging evidence suggests that GPR143 may play roles in several pathophysiological processes beyond melanogenesis:

  • Cancer progression and metastasis:

    • GPR143 has been proposed as a metastasis-promoting gene in melanoma progression

    • Researchers can investigate how GPR143 expression correlates with cancer outcomes

    • Studies may explore whether GPR143 modulators could serve as adjuvant therapies

  • Cardiovascular regulation:

    • GPR143 has been implicated in blood pressure regulation

    • Future research could examine GPR143 expression in cardiovascular tissues

    • Animal models with tissue-specific GPR143 modifications could reveal novel functions

  • Neurodevelopmental processes:

    • Given GPR143's role in the visual system development, investigations into broader neurodevelopmental functions are warranted

    • Studies might explore GPR143 expression patterns in different brain regions

    • Potential connections to other neurodevelopmental disorders could be evaluated

  • Age-related macular degeneration:

    • GPR143's function in the retinal pigment epithelium suggests possible links to macular degeneration

    • Research could focus on how GPR143 activity changes during aging

    • Therapeutic targeting of GPR143 might offer new approaches for retinal disorders

Understanding these broader roles could position GPR143 as a multifunctional signaling hub with relevance to diverse physiological systems and pathological conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.