Recombinant Mouse G-protein coupled receptor 161 (Gpr161)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Mouse Gpr161 refers to the full-length 529-amino acid protein expressed in heterologous systems for experimental use. Key production features include:

ParameterDetails
Expression HostEscherichia coli (E. coli), mammalian cells, or cell-free systems
Tag SystemsHis-tag (affinity purification), GST-tag (solubility enhancement)
Purity>90% (E. coli), 70–80% (cell-free systems)
Catalog ReferencesRFL22940MF (Creative BioMart), custom variants (Antibodies-Online)

This protein retains constitutive Gs-coupled activity, enabling cAMP production without exogenous ligands .

Constitutive Signaling Mechanism

  • ECL2 Autoregulation: Extracellular Loop 2 (ECL2) occupies the orthosteric ligand pocket, enabling ligand-independent activation .

  • Sterol Binding: A conserved extrahelical site adjacent to TM6/TM7 binds sterols, stabilizing the active conformation for Gs coupling . Mutations here (e.g., sterol-binding mutants) reduce cAMP production by 60–80% .

Hedgehog Pathway Repression

  • Ciliary Localization: Gpr161 localizes to primary cilia and suppresses GLI2 transcription factor accumulation via PKA binding .

  • AKAP Domain: The C-terminal A-kinase anchoring protein (AKAP) domain directly recruits PKA regulatory subunits, critical for Hedgehog inhibition .

Key Studies Using Recombinant Gpr161

Study FocusFindings
Hedgehog SignalingKnock-in Gpr161 mut1 mice showed defective Gli3 repressor processing, leading to neural tube patterning defects .
Cell ProliferationOverexpression in mammary epithelial cells increased mTOR signaling and multiacinar structure formation .
Structural BiologyCryo-EM resolved the Gpr161-Gs complex at 3.2 Å, revealing sterol-binding motifs critical for activation .

Disease Relevance

  • Cancer: Gpr161 overexpression in triple-negative breast cancer (TNBC) correlates with poor prognosis and promotes proliferation via β-arrestin 2/mTORC1 pathways .

  • Developmental Defects: Gpr161 knockout mice exhibit craniofacial malformations and polydactyly due to Hedgehog dysregulation .

Technical Considerations

  • Activity Validation: Constitutive cAMP production in transfected cells (e.g., HEK-293) confirms functional integrity .

  • Localization: Immunofluorescence confirms ciliary and peri-ciliary membrane localization in stable cell lines .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Gpr161; Gm208; G-protein coupled receptor 161
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-545
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDFVQHALLTASRGALTMSLNSSLSYRKELSNLTATEGGEGGAVSEFIAIIIITVLVCLG NLVIVVTLYKKSYLLTLSNKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSA LLYLLISSASMLTLGVIAIDRYYAVLYPMVYPMKITGNRAVMALVYIWLHSLIGCLPPLF GWSSVEFDEFKWMCVAAWHQEPGYTIFWQIWCALFPFLIMLVCYGFIFRVARVKARKVHC GTVVTVEEDSQRSGRKNSSTSTSSSGSRRNALQGVVYSANQCKALITILVVIGAFMVTWG PYMVVITSEALWGKNCVSPTLETWATWLSFTSAICHPLIYGLWNKTVRKELLGMCFGDRY YRESFVQRQRTSRLFSISNRITDLGLSPHLTALMAGGQSLGHSSSTGDTGFSYSQDSGTD VMLLEDGTSEDNPPQHCTCPPKRRSSVTFEDEVEQIKEAAKNSLLHVKAEVHKSLDSYAA SLAKAIEAEAKINLFGEEALPGVLFTARTVPGAGFGGRRGSRTLVNQRLQLQSIKEGNVL AAEQR
Uniprot No.

Target Background

Function
Gpr161 is a key negative regulator of Shh signaling. It promotes the processing of GLI3 into GLI3R during neural tube development. Gpr161 is recruited by TULP3 and the IFT-A complex to primary cilia. It functions as a regulator of the PKA-dependent basal repression machinery in Shh signaling by increasing cAMP levels. This leads to the promotion of PKA-dependent processing of GLI3 into GLI3R and the repression of Shh signaling. In the presence of SHH, Gpr161 is removed from primary cilia and internalized into recycling endosomes, preventing its activity and enabling activation of the Shh signaling pathway. The ligand for Gpr161 remains unidentified.
Gene References Into Functions
  1. Gpr161 plays a crucial role in forelimb formation, limb patterning, prevention of periarticular chondrocyte proliferation, and driving osteoblastogenesis in intramembranous bones, all in a cilium-dependent manner. PMID: 29222391
  2. These studies demonstrate that modifications in the Gpr161vl/vl cataract phenotype are likely due to genetic variations in at least one of three closely linked candidate genes on proximal Chromosome 15. PMID: 28135291
  3. Smoothened determines beta-arrestin-mediated removal of the G protein-coupled receptor Gpr161 from the primary cilium. PMID: 27002170
  4. Gpr161 is a G-protein coupled receptor that regulates the retinoic acid and canonical Wnt pathways during neurulation. PMID: 25753732
  5. Complete loss of Gpr161 in mice results in midgestation lethality and increased Shh signaling in the neural tube, mirroring the phenotype observed in Tulp3/IFT-A mutants. PMID: 23332756
  6. Characterization of the vl mutation reveals that the C-terminal tail of Gpr161 is truncated, leading to multiple effects on the protein, including reduced receptor-mediated endocytosis. PMID: 18250320
  7. Gpr161 is essential for left-right patterning. PMID: 18755178
Database Links
Involvement In Disease
An intragenic deletion in Gpr161 is responsible for the vacuolated lens (vl) phenotype that is characterized by neural tube defects and congenital cataracts. The vl mutation aroses spontaneously. About half of vl/vl embryos display lumbar-sacral spina bifida and die before birth, and the other half have closed neural tubes but show thinning of the midline neuroepithelium and epidermis, dilation of the dorsal ventricle, and presence of ectopic neuroepithelial cells in the ventricle. All surviving adults display congenital cataracts (PubMed:18250320). It is not a null mutant allele (PubMed:23332756).
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell projection, cilium membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Note=Mainly localizes to primary cilium in a TULP3 and IFT-A complex-dependent manner. In presence of SHH, it is removed from primary cilia and is internalized into recycling endosomes and is apparently not degraded.

Q&A

What is Gpr161 and why is it significant in developmental biology?

Gpr161 is an orphan G protein-coupled receptor that plays critical roles in embryonic development. Its significance stems from its involvement in neural tube formation and lens development. The receptor was identified through positional cloning of the vacuolated lens (vl) mouse mutant, which exhibits congenital cataracts and neural tube defects (NTDs). Gpr161 functions as one of the first genes necessary for neural fold apposition and fusion, making it a crucial component in understanding neurulation processes. The vl mutation affects receptor-mediated endocytosis, a common mechanism for attenuating GPCR signaling, suggesting that Gpr161 normally regulates downstream pathways necessary for neural fold fusion .

What signaling pathways does Gpr161 regulate?

Gpr161 functions as a Gαs-coupled receptor that activates cAMP signaling. Recent research has demonstrated that Gpr161 antagonizes Hedgehog (Hh) signaling at the primary cilium, creating a regulatory node between these two important developmental pathways. By directly recruiting type I protein kinase A (PKA) holoenzymes to the receptor, Gpr161 establishes a cAMP-sensing signalosome that can modulate downstream effectors. This activity creates a molecular hub that integrates receptor-sensed input signals with spatiotemporal cAMP dynamics to coordinate developmental processes .

How does Gpr161 differ from other G protein-coupled receptors?

Unlike most GPCRs, Gpr161 possesses intrinsic A-kinase anchoring protein (AKAP) functionality embedded within its C-terminal tail. This dual functionality allows Gpr161 to not only initiate signaling as a receptor but also to anchor PKA regulatory subunits directly, creating a consolidated signaling complex. This arrangement provides spatial and temporal control of cAMP signaling that differs from the typical GPCR signaling cascade that relies on separate scaffolding proteins. The presence of an amphipathic helix in the C-terminal tail (spanning from L458 to L477) mediates high-affinity binding with the PKA regulatory subunit RIα, but notably does not interact with RIIβ homodimers, demonstrating remarkable binding selectivity .

What is known about the structure-function relationship of Gpr161's C-terminal domain?

The C-terminal tail of Gpr161 contains a critical amphipathic helix spanning amino acids 458-477 that mediates interaction with PKA regulatory subunits. This region functions as an AKAP-like domain with remarkable selectivity for binding PKA type I regulatory subunits (specifically RIα) with high affinity (Kd of 6.0 nM). The structure-function relationship involves six conserved binding pockets (shown in red in published structural models) that dock onto the hydrophobic groove of the RIα dimer. The structural model reveals that the RIα dimerization/docking (D/D) domain consists of an antiparallel, four-helix bundle that forms the interaction surface with Gpr161. Notably, position E470 (E13 in the helix numbering) in Gpr161 is unusual for an amphipathic helix, as its side chain points toward the linker between two RI helices, with the negative charge potentially compensated by the neighboring K17 residue in RIα .

How can researchers experimentally verify Gpr161-PKA interactions?

Several complementary experimental approaches can be employed to verify Gpr161-PKA interactions:

  • GST pulldown assays: Using GST-fused C-terminal variants of Gpr161 to pull down recombinant RIα-his6 in vitro. Truncated hybrid variants containing the predicted amphipathic helix show binary interaction with RIα, while variants with mutations such as L465P (L8 in helix numbering) abolish binding .

  • Fluorescence polarization measurements: Using 5-FAM N-terminal labeled Gpr161 peptide (corresponding to Gpr161 457-481) with full-length RIα and RIIβ purified proteins. This approach can quantitatively determine binding affinity (Kd) and confirm binding selectivity .

  • Dot blot analyses: Comparing binding of recombinant RIα to different amphipathic helices, including sequences from Gpr161-CT. Pro substitutions located in the specific R binding pockets can serve as negative controls .

  • Renilla Luciferase Protein-fragment Complementation Assay (Rluc PCA): Using fusion proteins of Gpr161 with Rluc PCA fragments to detect protein-protein interactions in live cells. This method allows testing of interactions with PKA subunits and the effects of mutations such as RIβ[L50R] that affect the integrity of the D/D domain .

What are the key differences in Gpr161 binding to RI versus RII PKA subunits?

Gpr161 exhibits highly selective binding to PKA type I regulatory subunits (RI) but not to type II regulatory subunits (RII). This selectivity is demonstrated through multiple experimental approaches:

  • Fluorescence polarization measurements show high-affinity binding of Gpr161 peptide (457-481) to RIα with a Kd of 6.0 nM, while no binding to RIIβ homodimer is observed .

  • Structure-based alignments and modeling reveal that the selectivity likely stems from structural differences between RI and RII D/D domains. The D/D domains of RIα feature a more extended hydrophobic surface at the N-terminus that includes a third helix (α0-Helix) instead of the short strand found in RII subunits .

  • In addition to the four hydrophobic pockets common to AKAP interaction motifs, the N- and C-terminal Leu residues (L1, L20) in RI create two additional pockets that may account for the selective binding of Gpr161 .

This selective binding profile makes Gpr161 unique among AKAPs, as most canonical AKAPs preferentially bind to RII subunits or function as dual-specificity AKAPs binding both RI and RII.

What is the expression pattern of Gpr161 during embryonic development?

Gpr161 displays a highly restricted and dynamic expression pattern during embryonic development:

  • Temporal expression: RT-PCR demonstrates that Gpr161 is expressed from embryonic day E8.5 to E11.5 .

  • Neural tissue: In situ hybridization reveals Gpr161 expression restricted to the lateral neural folds of the neural plate along the anterior-posterior axis (E8.0-E9.5), consistent with its role in neural fold fusion. It is also expressed in the ventricular zone of the developing CNS from E9.5 to E11.5 .

  • Lens development: Gpr161 is expressed at all examined stages of lens development: lens pit (E10.5), lens vesicle (E11.5), primary lens fiber cells (E12.5), and differentiating secondary lens fiber cells (E14.5). Expression is highest at the lens pit stage and in differentiating secondary lens fiber cells, while being weakly expressed in the lens vesicle and primary lens fiber cells. Importantly, Gpr161 transcripts are restricted to differentiating lens fiber cells and are absent from the proliferating anterior lens epithelium at E12.5 and E14.5 .

  • Other structures: Gpr161 is also expressed in the fore and hindlimbs (E12.5) and the retina (E10.5-E14.5), suggesting roles in limb and eye development beyond lens formation .

This spatiotemporally restricted expression pattern aligns with the phenotypes observed in Gpr161 mutants, particularly the neural tube defects and congenital cataracts.

How does Gpr161 contribute to neural tube development?

Gpr161 plays a crucial role in the final stages of neural tube closure, specifically in neural fold apposition and fusion:

  • Mechanism: While Gpr161 is not involved in the initial elevation and bending of the neural plate, it regulates the pathways required for neural fold apposition and fusion. This is consistent with embryonic culture studies of vl mutants showing normal elevation and bending but abnormal apposition and fusion .

  • Cellular basis: Electron microscopy studies reveal that normal embryos develop cellular protrusions that extend from the apical neural folds and interdigitate upon contact during neural fold fusion. In vl mutants, these cellular protrusions have abnormal ultrastructural morphology, suggesting Gpr161 regulates cytoskeletal dynamics or cell adhesion processes necessary for neural fold fusion .

  • Signaling context: Neural tube closure involves coordination between signals from the notochord (including Sonic hedgehog) that induce medial bending, and signals from the adjacent lateral surface ectoderm required for elevation, dorso-lateral bending, and formation and fusion of the neural folds. Gpr161 expressed in the lateral neural folds likely responds to extracellular ligands present in this environment to regulate neural fold apposition and fusion .

  • Hedgehog pathway interaction: Gpr161 antagonizes Hedgehog (Hh) signaling at the primary cilium, creating a regulatory balance between these pathways critical for proper neural tube patterning and closure .

Understanding these mechanisms has significant implications for human neural tube defects, which are among the most common birth defects worldwide.

How does the vacuolated lens (vl) mutation affect Gpr161 function?

The vacuolated lens (vl) mutation results in a truncation of the C-terminal tail of Gpr161, leading to multiple functional consequences:

  • Structural impact: The mutation truncates the C-terminal tail that contains the amphipathic helix (amino acids 458-477) essential for PKA binding, disrupting the AKAP-like functionality of Gpr161 .

  • Cellular trafficking effects: The mutation reduces receptor-mediated endocytosis, a common mechanism used to attenuate GPCR signaling. This suggests that proper trafficking and internalization of Gpr161 are critical for its developmental functions .

  • Phenotypic consequences: The mutation causes two primary phenotypes - congenital cataracts resulting from defective lens development and neural tube defects caused by abnormal neural fold apposition and fusion. The expression pattern of Gpr161 in the lateral neural folds and developing lens is consistent with these phenotypes .

  • Signaling disruption: The truncation likely impairs the ability of Gpr161 to recruit PKA and establish cAMP-sensing signalosomes, disrupting downstream signaling required for neural tube closure and lens development .

Importantly, RT-PCR and in situ hybridization (at E9.5) demonstrate no difference in Gpr161 expression levels in vl/vl embryos, indicating that the mutation affects protein function rather than transcriptional regulation .

What genetic modifiers influence Gpr161-related phenotypes?

Gpr161-related phenotypes are influenced by multiple genetic modifiers, making the vl mutation a valuable model for studying the multigenic basis of neural tube defects and cataracts:

  • Quantitative trait loci (QTL): Three modifier QTLs have been mapped that affect the incidence of either the vl cataract or neural tube defect phenotypes, demonstrating the complex genetic architecture underlying these developmental processes .

  • Foxe3 as a direct modifier: Bioinformatic, sequence, genetic, and functional data have identified Foxe3, a key regulator of lens development, as a gene responsible for the vl cataract-modifying phenotype. This genetic interaction between Gpr161 and Foxe3 represents a specific modifier relationship in lens development .

  • Strain-dependent effects: The penetrance and expressivity of vl phenotypes vary across different mouse genetic backgrounds, further supporting the role of genetic modifiers in determining the outcome of Gpr161 dysfunction .

Understanding these genetic modifiers provides insight into the multifactorial basis of neural tube defects and cataracts and may inform approaches to identifying susceptibility loci in human populations.

What human disorders might be associated with GPR161 mutations?

Several human disorders may be associated with GPR161 mutations based on the mouse phenotypes and molecular functions:

  • Combined cataracts and NTDs: Several rare human disorders display both congenital cataracts and neural tube defects, making GPR161 an appropriate candidate gene for these conditions .

  • Embryonic hydromyelia: Based on the neural tube phenotypes in mice, GPR161 may be implicated in human embryonic hydromyelia, a condition involving abnormal fluid-filled cavities in the spinal cord .

  • Isolated congenital cataracts: Given the role of Gpr161 in lens development, mutations in GPR161 could be involved in isolated congenital cataracts in humans. This approach has been successful for other genes that cause cataracts in mice (PAX6, PITX3, FOXE3) .

  • Ciliopathies: Since Gpr161 functions at the primary cilium to regulate Hedgehog signaling, mutations might contribute to human ciliopathies, which often present with developmental abnormalities in multiple organ systems .

Future association analysis could test whether GPR161 and the vl modifiers are susceptibility loci for these human conditions, providing insight into their multifactorial basis.

What techniques can researchers use to study Gpr161 expression patterns?

Researchers can employ several complementary techniques to study Gpr161 expression patterns:

  • RT-PCR: For temporal expression analysis across developmental stages, RT-PCR provides a reliable method to detect Gpr161 mRNA expression. This approach has been used to demonstrate Gpr161 expression from E8.5 to E11.5 in mouse embryos .

  • In situ hybridization (ISH): For spatial expression analysis, ISH provides detailed information about tissue-specific expression patterns. This technique has revealed Gpr161 expression in the lateral neural folds, developing lens, retina, limb buds, and ventricular zone of the developing CNS .

  • Fluorescent reporter constructs: Creating transgenic animals with fluorescent reporters driven by the Gpr161 promoter can enable live imaging of expression patterns and cell-type specificity.

  • Immunohistochemistry: Using antibodies against Gpr161 can reveal protein localization at the cellular and subcellular levels, complementing mRNA expression data.

  • Single-cell RNA sequencing: This advanced technique can provide comprehensive expression profiles at single-cell resolution, revealing cell-type-specific expression patterns that might be missed by bulk tissue analysis.

For optimal results, researchers should combine multiple approaches to validate expression patterns and distinguish between transcriptional and post-transcriptional regulation of Gpr161.

What methods are effective for studying Gpr161 protein interactions?

Several methods have proven effective for studying Gpr161 protein interactions, particularly with PKA subunits:

  • GST pulldown assays: Using GST-fused C-terminal variants of Gpr161 to pull down interaction partners from cell lysates or recombinant proteins. This approach has successfully demonstrated binary interactions between Gpr161 CT and RIα .

  • Fluorescence polarization: Using fluorescently labeled Gpr161 peptides (e.g., 5-FAM N-terminal labeled Gpr161 peptide 457-481) with purified protein partners to quantitatively measure binding affinities. This approach determined the Kd of Gpr161-RIα interaction to be 6.0 nM .

  • Dot blot analyses: Comparing binding of recombinant proteins to different peptide sequences spotted on membranes. This approach has confirmed specific binding of RIα to sequences from the predicted amphipathic helix in Gpr161-CT .

  • Renilla Luciferase Protein-fragment Complementation Assay (Rluc PCA): This live-cell assay uses fusion proteins with fragments of Renilla luciferase to detect protein-protein interactions in cellular contexts. The technique has been used to study interactions between Gpr161 and PKA subunits, including disease-relevant mutants like RIβ[L50R] .

  • Co-immunoprecipitation: Traditional co-IP approaches can validate interactions in cellular contexts and can be combined with mass spectrometry to identify novel interaction partners.

The selection of method should be guided by the specific research question, with consideration of whether in vitro or cellular contexts are more appropriate for the interaction being studied.

How can researchers generate and validate recombinant Gpr161 for functional studies?

Generating and validating recombinant Gpr161 for functional studies requires careful consideration of several factors:

Production Strategies:

  • Expression systems: For full-length Gpr161, mammalian expression systems (HEK293, CHO cells) are recommended due to the complex membrane topology and post-translational modifications of GPCRs. For the C-terminal domain only, bacterial systems may be sufficient .

  • Fusion tags: Addition of affinity tags (His6, GST, etc.) facilitates purification, while fluorescent protein fusions (Venus-YFP, etc.) enable visualization and functional assays .

  • Domain-specific constructs: For studying specific functions like PKA binding, constructs focusing on the C-terminal tail (e.g., Gpr161 CT 340-528) can be more manageable than full-length protein .

Validation Methods:

  • Western blotting: Confirms expression and expected molecular weight of recombinant proteins.

  • Functional assays: For full-length Gpr161, cAMP accumulation assays can verify its ability to couple to Gαs and activate adenylyl cyclase.

  • Binding assays: Fluorescence polarization or pulldown experiments can confirm the ability of the C-terminal domain to bind PKA regulatory subunits with expected affinity and specificity .

  • Subcellular localization: Immunofluorescence or live cell imaging of fluorescent protein fusions can verify proper trafficking to the plasma membrane and/or primary cilium.

  • Mutagenesis: Generating key mutants (e.g., L465P in the amphipathic helix) can serve as negative controls to validate specific functions .

For structure-function studies, researchers should consider using both the full-length receptor and isolated domains to comprehensively characterize Gpr161's multiple functionalities.

What is the identity of the endogenous ligand for Gpr161?

Despite significant advances in understanding Gpr161 function, its endogenous ligand remains unknown, classifying it as an orphan GPCR. Several approaches can be employed to identify this ligand:

  • Candidate-based approaches: Testing putative ligands based on Gpr161's developmental expression pattern and signaling pathways. Given its role in neural tube closure, molecules present in the neural environment during neurulation are prime candidates .

  • Unbiased screening: High-throughput screening of tissue extracts, peptide libraries, or small molecule collections using cells expressing Gpr161 and monitoring cAMP production or PKA activity as readouts.

  • Reverse pharmacology: Starting with Gpr161 signaling pathways and working backward to identify molecules that modulate these pathways in a Gpr161-dependent manner.

  • Computational approaches: Using structural modeling of the Gpr161 ligand-binding domain to predict potential ligands, followed by experimental validation.

Identification of the Gpr161 ligand would significantly advance our understanding of the extracellular signals regulating neural fold fusion and lens development, potentially providing new therapeutic targets for related developmental disorders .

How does the AKAP-like function of Gpr161 integrate with its GPCR signaling properties?

The dual functionality of Gpr161 as both a GPCR and an AKAP raises fascinating questions about signal integration:

  • Temporal coordination: How does binding of an extracellular ligand to Gpr161 affect its AKAP function? Does receptor activation enhance or inhibit PKA binding to the C-terminal domain?

  • Spatial regulation: Does PKA binding to Gpr161 affect receptor localization, particularly in primary cilia where Gpr161 antagonizes Hedgehog signaling?

  • Feedback mechanisms: Does PKA phosphorylation of Gpr161 (potentially at multiple sites in the C-terminal domain) regulate receptor activity, creating a feedback loop between the GPCR and AKAP functions?

  • Pathway crosstalk: How does the consolidated Gpr161-PKA signaling complex modulate cross-talk between cAMP and Hedgehog signaling pathways?

These questions represent a frontier in understanding how Gpr161 creates a cAMP-sensing signalosome that integrates receptor-sensed input signals with spatiotemporal cAMP dynamics .

What are the implications of Gpr161's selective binding to PKA type I regulatory subunits?

The selective binding of Gpr161 to PKA type I regulatory subunits (particularly RIα) rather than type II has significant implications for signaling specificity:

  • Compartmentalized signaling: Type I PKA holoenzymes typically have different subcellular distributions than type II, suggesting Gpr161 may recruit PKA to specific cellular compartments, particularly primary cilia .

  • Differential activation properties: Type I PKA holoenzymes are typically more sensitive to cAMP than type II, potentially enabling Gpr161-anchored PKA to respond to smaller changes in cAMP levels.

  • Disease relevance: Mutations in PKA regulatory subunits affect their interaction with Gpr161, as demonstrated with the RIβ[L50R] mutation associated with neurodegenerative disorders. This suggests that disrupted Gpr161-PKA complexes may contribute to disease mechanisms .

  • Evolutionary conservation: The selective binding to RI subunits may reflect evolutionary conservation of specific signaling pathways required for neural tube closure and lens development.

Future research should explore whether Gpr161 is unique in this selectivity or represents a broader class of GPCRs with intrinsic AKAP function, which would significantly expand our understanding of compartmentalized GPCR-cAMP signaling .

Data Table: Binding Properties of Gpr161 to PKA Regulatory Subunits

Regulatory SubunitBinding Affinity (Kd)Method of DeterminationKey Amino Acids in Gpr161Notes
RIα6.0 ± 0.1 nMFluorescence polarizationL458-L477 (amphipathic helix)High-affinity binding, cAMP-insensitive interaction
RIβPresent, not quantifiedRluc PCAL458-L477 (amphipathic helix)RIβ[L50R] mutation substantially reduces interaction
RIIβNo binding detectedFluorescence polarization, GST pulldownN/AComplete selectivity against RII subunits

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.