Recombinant Mouse G-protein coupled receptor 183 (Gpr183)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse GPR183

G protein-coupled receptor 183 (GPR183), also known as EBI2 (Epstein-Barr virus-induced gene 2), is a class A rhodopsin-like GPCR critical for oxysterol sensing and immune cell migration. Recombinant GPR183 refers to genetically engineered variants of this receptor, often expressed in heterologous systems (e.g., mammalian cells or Xenopus laevis oocytes) for functional studies. Its recombinant forms enable precise investigation of ligand-receptor interactions, signaling cascades, and therapeutic applications .

Signaling Pathways

GPR183 activates diverse pathways depending on cellular context:

PathwayMechanismBiological OutcomeReferences
PI3K-mTORMediates methionine-induced milk synthesis in mammary cells via AKT/mTOR phosphorylationEnhanced lactation, cell proliferation
β-arrestin-Nedd4Recruits β-arrestin1 and E3 ligase Nedd4 to degrade Notch1 in hematopoietic endothelial cellsFacilitates endothelial-to-hematopoietic transition (EHT)
cAMP-PKA-CREBDisrupts circadian PER1 signaling, promoting endothelial senescence in hypertensionAggravates cardiovascular/renal injuries

Functional Studies in Mammary Epithelial Cells

CRISPR/dCas9-VPR System:

  • Method: Co-transfection of pSPgRNA (sgRNA targeting GPR183 promoter) and SP-dCas9-VPR (containing VP64, p65, and Rta domains) to activate GPR183 transcription .

  • Outcomes:

    ParameterGPR183 KnockdownGPR183 OverexpressionReference
    β-casein protein levels↓ 40–60%↑ 50–70%
    TAG content↓ 30–50%↑ 60–80%
    Cell proliferation↓ 25–40%↑ 20–35%

Role in Hematopoietic Stem Cell Development

Zebrafish and Mouse Models:

  • GPR183 Knockout: Abolishes hematopoietic stem/progenitor cell (HSPC) emergence by upregulating Notch1 .

  • 7α,25-OHC Treatment: Restores HSPC emergence via β-arrestin1-dependent Notch1 degradation .

Detection and Validation Tools

Anti-GPR183 Antibodies:

AntibodyTargetApplicationReference
AGR-063-F (FITC)Extracellular N-terminusFlow cytometry in mouse J774 macrophages and human Jurkat T-cells

Hypertension and Endothelial Dysfunction

  • GPR183 Overexpression: Promotes endothelial senescence via PER1 suppression, exacerbating hypertension .

  • Pharmacological Inhibition: NIBR189 or clotrimazole (oxysterol-GPR183 antagonists) reduce senescence and improve cardiovascular outcomes .

Cancer Therapeutics

  • Burkitt Lymphoma: GPR183 upregulation enhances macrophage infiltration and tumor cell elimination when combined with CD20/CD47/PI3Kδ targeting .

  • Acute Myeloid Leukemia (AML): High GPR183 expression correlates with poor prognosis; knockdown improves survival in AML mouse models .

Future Directions

  1. Structural Biology: High-resolution crystallography to map GPR183-7α,25-OHC interactions .

  2. Therapeutic Targeting: Small-molecule agonists/antagonists for immune modulation and cardiovascular diseases .

  3. Circadian Regulation: Investigating GPR183’s role in PER1-mediated endothelial aging .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Gpr183; Ebi2; G-protein coupled receptor 183; Epstein-Barr virus-induced G-protein coupled receptor 2 homolog; EBI2; EBV-induced G-protein coupled receptor 2 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MANNFTTPLATSHGNNCDLYAHHSTARVLMPLHYSLVFIIGLVGNLLALVVIVQNRKKIN STTLYSMNLVISDILFTTALPTRIAYYALGFDWRIGDALCRVTALVFYINTYAGVNFMTC LSIDRFFAVVHPLRYNKIKRIEYAKGVCLSVWILVFAQTLPLLLTPMSKEEGDKTTCMEY PNFEGTASLPWILLGACLLGYVLPITVILLCYSQICCKLFRTAKQNPLTEKSGVNKKALN TIILIIVVFILCFTPYHVAIIQHMIKMLCSPGALECGARHSFQISLHFTVCLMNFNCCMD PFIYFFACKGYKRKVMKMLKRQVSVSISSAVRSAPEENSREMTESQMMIHSKASNGR
Uniprot No.

Target Background

Function
G-protein coupled receptor 183 (GPR183) is a lymphocyte-expressed receptor functioning as a chemotactic receptor for B-cells, T-cells, splenic dendritic cells, monocytes/macrophages, and astrocytes. It is a receptor for the oxysterol 7α,25-dihydroxycholesterol (7α,25-OHC) and related oxysterols, mediating cell positioning and movement through 7α,25-OHC-mediated chemotactic gradient formation. 7α,25-OHC binding facilitates precise B-cell localization during humoral immune responses. GPR183 collaborates with CXCR5, potentially forming a heterodimer influencing CXCL13-CXCR5 interactions and guiding B-cell movement within lymphoid tissues. Its expression during B-cell maturation ensures appropriate positioning for T-dependent antibody responses. It also acts as a chemotactic receptor for certain T-cells upon 7α,25-OHC binding, promoting follicular helper T (Tfh) cell differentiation by positioning activated T-cells at the follicle-T-zone interface. This facilitates contact between activated CD4 T-cells and dendritic cells, exposing them to ICOS ligand. Splenic dendritic cell expression is vital for their homeostasis, localization, and ability to induce B- and T-cell responses; GPR183 acts as a chemotactic receptor mediating CD4+ dendritic cell accumulation. It also regulates astrocyte migration and astrocyte-macrophage communication, and promotes osteoclast precursor migration to bone surfaces. GPR183 signals constitutively through G(i)α, but not G(s)α or G(q)α, and also constitutively via MAPK1/3 (ERK1/2).
Gene References Into Functions
  1. This study supports the hypothesis that EBI2/oxysterol signaling modulates both immune cell function and astrocytic responses to inflammatory stimuli. PMID: 29374507
  2. GPR183 promotes lymphoid organ development, and oxysterol-GPR183 signaling influences group 3 innate lymphoid cell activity and intestinal homeostasis. PMID: 29343433
  3. This research demonstrates a novel role for EBI2 in myelin development and protection against demyelination. PMID: 29246262
  4. Data suggests that EBI2 signaling is sensitive to pro-inflammatory signals, playing a role in astrocyte-macrophage communication. PMID: 27166278
  5. EBI2-expressing cells are abundant in multiple sclerosis (MS) white matter lesions. PMID: 28147280
  6. These data establish a role for EBI2 in promoting efficient thymic central tolerance. PMID: 28741728
  7. Mice lacking EBI2 in T cells or CD25 in dendritic cells exhibit reduced T follicular helper cells and impaired T-cell-dependent plasma cell and germinal center responses. PMID: 27147029
  8. Findings highlight an essential role for EBI2 in CD4(+) DC positioning and homeostasis, and in facilitating the capture and presentation of blood-borne particulate antigens. PMID: 23682316
  9. EBI2 negatively regulates type I interferons in plasmacytoid and myeloid dendritic cells. PMID: 24386204
  10. Regulated EBI2 expression on DC populations is crucial for splenic DC generation, positioning, and immune response initiation. PMID: 23502855
  11. EBI2 regulates B-cell migration, controlling the positioning of activated B cells within lymphoid follicles during early B-cell responses, differentiation, and affinity maturation. PMID: 21948984
  12. EBI2 plays a role in controlling B-cell positioning at various stages of the antibody response. PMID: 21844396
  13. This research identifies a ligand targeting EBI2, offering a valuable tool for further EBI2 characterization and as a potential drug candidate. PMID: 21673108
  14. EBI2 promotes B-cell localization in the outer follicle, assisting in positioning B-cells for T-dependent antibody responses. PMID: 19597478
  15. EBI2 influences B-cell migration, affecting the coordination of rapid and long-term antibody responses. PMID: 19615922
Database Links

KEGG: mmu:321019

UniGene: Mm.265618

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in mature B-cells and increases in expression early after activation, before being down-regulated in germinal center B-cells. Expressed in astrocytes. Specifically expressed in CD4(+) dendritic cells but not in CD8(+) dendritic cells. Expressed

Q&A

What is Recombinant Mouse Gpr183 and what are its basic specifications?

Recombinant Mouse Gpr183 is a G-protein coupled receptor expressed as either a full-length or partial-length protein. It belongs to the rhodopsin family and is widely expressed in B cells, T cells, and dendritic cells, where it regulates positioning and migration of immune cells within secondary lymphoid organs .

The recombinant protein is typically produced in mammalian cell expression systems with the following specifications:

  • Source: Mammalian cells

  • Tag: Often includes a His-tag for purification

  • Form: Available as liquid or lyophilized powder

  • Purity: Generally >80%

  • Endotoxin: <1.0 EU per μg of protein (as determined by LAL method)

  • Storage buffer: Phosphate-buffered saline (PBS)

  • Storage conditions: +4°C for short-term storage; -20°C to -80°C for long-term storage

What genomic and sequence information is available for Mouse Gpr183?

Mouse Gpr183 has been well-characterized at the genomic level with the following parameters:

ParameterInformation
Gene NameGpr183 G protein-coupled receptor 183
SpeciesMus musculus
Official SymbolGPR183
Gene ID321019
mRNA RefSeqNM_183031.2
Protein RefSeqNP_898852.2
UniProt IDQ3U6B2

This genomic information is essential for designing experiments that involve genetic manipulation of Gpr183, including the creation of knockout models or expression vectors .

What are the primary biological functions of Gpr183 in the immune system?

Gpr183 plays several critical roles in the immune system:

  • Regulation of immune cell positioning and migration within secondary lymphoid organs, which is crucial for proper immune response development

  • Antagonism of chemokine-mediated B cell migration, as evidenced by transwell migration assays using recombinant CXCL12 as a chemoattractant. Studies show that Gpr183 inhibition or knockout significantly impacts cell mobility and migration patterns

  • Modulation of F-actin polymerization, which affects immune cell movement and function. Research demonstrates that the absence or pharmacological blockade of Gpr183 counteracts decreases in F-actin polymerization typically observed in certain therapeutic contexts

  • Mediation of interactions between immune cells, particularly in the context of macrophage recruitment and activation. Experimental evidence shows that knockout or inhibition of Gpr183 abrogates macrophage infiltration in tumor models

Understanding these functions is essential for researchers designing experiments to investigate immune responses, particularly in the context of lymphoid tissue development and organization.

How is Gpr183 expression regulated in different cell types?

Gpr183 exhibits distinct expression patterns across immune cell populations:

  • Highest expression is observed in dendritic cells (DCs), with approximately 42% of conventional DCs and 37% of plasmacytoid DCs showing positive expression

  • B cells and CD4+ T cells also express Gpr183, but at lower frequencies compared to DCs

  • Expression in monocytes is more sporadic and variable across different monocyte subpopulations

  • Expression patterns vary in response to stimuli, as demonstrated in vaccination studies where Gpr183 exhibited complex response patterns that differed with each dose

These cell type-specific expression patterns suggest that Gpr183 may have distinct roles in different immune cell populations, warranting cell-specific approaches when designing experiments to study its function.

What are the optimal storage and handling conditions for Recombinant Mouse Gpr183?

For optimal activity and stability of Recombinant Mouse Gpr183:

  • Short-term storage: Maintain at +4°C for up to one week

  • Long-term storage: Store at -20°C to -80°C, preferably in small aliquots to avoid repeated freeze-thaw cycles

  • Buffer conditions: The protein is typically stable in PBS buffer, but specific applications may require optimization of buffer composition

  • Handling precautions: Minimize exposure to room temperature and avoid repeated freeze-thaw cycles as these can lead to protein denaturation and loss of activity

  • Reconstitution of lyophilized material: When working with lyophilized preparations, reconstitute using sterile buffer, preferably filtered to maintain sterility

Following these guidelines will help maintain the structural integrity and functional activity of the recombinant protein for experimental applications.

What methods are effective for Gpr183 knockout or inhibition studies?

Researchers have successfully employed several approaches to study Gpr183 function through knockout or inhibition:

  • CRISPR/Cas9 gene editing: This has been successfully used to generate Gpr183 knockout cell lines (e.g., Raji-GPR183 KO single-clones). These genetic models allow for comprehensive assessment of Gpr183 function in cellular processes

  • Pharmacological inhibition: The selective Gpr183 inhibitor NIBR189 has been effectively used in experimental setups. Typically, cells are exposed to NIBR189 for a defined period (e.g., 1 hour), followed by wash-out before proceeding with functional assays

  • Validation of knockout/inhibition: Researchers should confirm the efficacy of knockout or inhibition through:

    • Western blot analysis for protein expression

    • Functional assays such as chemotaxis or cell migration assays

    • Verification of downstream signaling pathway alterations

  • Phenotypic characterization: Complete assessment should include analysis of:

    • Cell migration capabilities (using transwell assays)

    • F-actin polymerization (which can be decreased by ~70% in certain contexts upon Gpr183 deletion)

    • Inflammatory gene expression profiles

    • Cell-cell interaction dynamics

These methods provide complementary approaches to investigate Gpr183 function in various biological contexts.

How does Gpr183 contribute to tumor recognition and immune response in cancer models?

Gpr183 plays a crucial role in tumor recognition and immune response in cancer models, particularly in B-cell malignancies:

  • Macrophage infiltration and activation: Studies with Raji-GPR183 knockout models demonstrated that Gpr183 is essential for macrophage infiltration into tumor spheroids. Absence of Gpr183 resulted in complete abrogation of macrophage infiltration within multicellular aggregates, both at basal levels and in response to therapeutic interventions

  • Antibody-dependent cellular phagocytosis (ADCP): Research shows that ADCP activity is severely compromised in Gpr183-knockout cell cultures, highlighting the critical role of Gpr183 in macrophage recruitment and activation after therapeutic targeting of cancer cells

  • Antibody-dependent cellular cytotoxicity (ADCC): While ADCC is also affected by Gpr183 knockout, the impact is less profound compared to ADCP, suggesting differential regulation of these immune effector mechanisms

  • Inflammatory signaling: Gpr183 is required for the induction of inflammatory gene signatures, particularly CCL20 overexpression, which further contributes to anti-tumor immune responses

  • In vivo relevance: Gpr183 knockout models showed resistance to anti-tumor therapies in chorioallantoic membrane (CAM) tumor models, with no modulation of CCL20 expression and failed intratumoral infiltration of macrophages

These findings suggest that Gpr183 status could be an important consideration in the design of immunotherapeutic approaches for B-cell malignancies.

What is the significance of the MX2/GPR183 ratiometric transcript signature in immune response studies?

The MX2/GPR183 ratiometric transcript signature has emerged as an important biomarker in immune response studies:

  • Predictive value: This signature has been consistently associated with protection in vaccine studies. Logistic regression models incorporating the MX2/GPR183 ratio demonstrated significant discriminatory power between protected and non-protected individuals following vaccination

  • Complex expression dynamics: While MX2 tends to be induced 24 hours after vaccination, GPR183 exhibits a more complex expression pattern that differs with each dose. Generally, lower GPR183 levels were observed in volunteers who would ultimately be protected

  • Correlation with protein levels: Analyses of tumor tissue proteogenomic data revealed that GPR183 transcript levels correlate significantly with GPR183 protein levels, including various phosphorylated forms (e.g., S343, S328, S333, S337), suggesting that transcript measurements provide meaningful insight into protein activity

  • Potential mechanistic interpretation: Reduced blood GPR183 RNA levels in protected individuals may reflect enhanced migration of GPR183-expressing cells to lymphoid tissues, potentially leading to more robust adaptive immune responses

  • Complementarity with other markers: The MX2/GPR183 ratio provides complementary information to traditional markers such as anti-CSP titers, potentially enhancing the predictive power of immune response assessments

Statistical ParameterValue
ROC AUC (STUDY+Log2(MX2/GPR183) model)0.76
p-value (Chi-squared test)2 × 10^-5

This signature represents a valuable tool for researchers studying immune responses, particularly in vaccine development and evaluation contexts.

What are common challenges in working with Recombinant Mouse Gpr183 and how can they be addressed?

Researchers working with Recombinant Mouse Gpr183 may encounter several technical challenges:

  • Protein stability and activity:

    • Challenge: Loss of activity during storage or experimental manipulation

    • Solution: Maintain strict temperature control, minimize freeze-thaw cycles, and consider adding stabilizing agents such as glycerol or bovine serum albumin to storage buffers

  • Expression system considerations:

    • Challenge: Variations in post-translational modifications depending on the expression system

    • Solution: For studies requiring specific post-translational modifications, select mammalian expression systems that closely mimic natural processing

  • Functional assays:

    • Challenge: Determining appropriate readouts for Gpr183 activity

    • Solution: Consider multiple complementary assays, including chemotaxis, F-actin polymerization, and downstream signaling pathway activation

  • Specificity of inhibitors:

    • Challenge: Potential off-target effects of pharmacological inhibitors

    • Solution: Validate results using genetic approaches (e.g., CRISPR/Cas9 knockout) in parallel with pharmacological inhibition

  • Interpretation of complex expression patterns:

    • Challenge: Gpr183 exhibits complex expression dynamics that vary by cell type and stimulus

    • Solution: Perform single-cell analyses (e.g., flow cytometry or single-cell RNA-Seq) to resolve cell type-specific responses

Addressing these challenges requires careful experimental design and appropriate controls to ensure reliable and reproducible results.

How can researchers validate the functional activity of Recombinant Mouse Gpr183 preparations?

Validating the functional activity of Recombinant Mouse Gpr183 preparations is crucial for experimental success:

  • Binding assays:

    • Ligand binding assays using known Gpr183 ligands

    • Competition assays with known Gpr183 antagonists such as NIBR189

  • Signaling pathway activation:

    • Assessment of downstream signaling components

    • Measurement of second messenger production (e.g., calcium flux, cAMP levels)

  • Functional cellular assays:

    • Chemotaxis assays using transwell migration systems with CXCL12 as a chemoattractant

    • F-actin polymerization assays, which can serve as a readout for Gpr183 activity

  • Comparative analysis:

    • Side-by-side comparison with established reference standards

    • Benchmarking against published data on dose-response relationships

  • Positive and negative controls:

    • Inclusion of Gpr183 knockout cells as negative controls

    • Use of pharmacological inhibitors (e.g., NIBR189) to confirm specificity of observed effects

A multi-faceted approach to validation ensures that experimental observations truly reflect Gpr183 function rather than artifacts or non-specific effects.

What emerging research areas involve Recombinant Mouse Gpr183?

Several promising research directions are emerging for Recombinant Mouse Gpr183:

  • Post-translational regulation mechanisms:

    • Investigation of phosphorylation sites (S343, S328, S333, S337) and their functional significance

    • Assessment of how phosphorylation status affects Gpr183 activity and signaling

  • Cell type-specific functions:

    • Detailed characterization of Gpr183 functions in different immune cell populations

    • Use of conditional knockout models to delineate cell-specific roles

  • Role in immunotherapeutic approaches:

    • Exploration of Gpr183 as a potential target or biomarker for cancer immunotherapy

    • Development of strategies to modulate Gpr183 activity to enhance anti-tumor immune responses

  • Vaccine response biomarkers:

    • Further validation of the MX2/GPR183 ratio as a predictive biomarker for vaccine efficacy

    • Integration with other immune parameters to develop comprehensive response prediction models

  • Single-cell analyses:

    • Application of single-cell RNA-Seq or flow cytometry to resolve cell type-specific Gpr183 expression patterns

    • Investigation of heterogeneity in Gpr183 expression and function within nominally homogeneous cell populations

These emerging areas represent significant opportunities for researchers to contribute to the understanding of Gpr183 biology and its potential clinical applications.

How might Gpr183 research contribute to therapeutic development in immune-related diseases?

Gpr183 research holds significant potential for therapeutic development in immune-related diseases:

  • Cancer immunotherapy:

    • Gpr183 modulation could enhance macrophage infiltration and phagocytic activity against tumor cells

    • Combination approaches targeting Gpr183 alongside established immunotherapeutic agents might improve efficacy

  • Inflammatory disorders:

    • Given Gpr183's role in immune cell positioning and migration, targeting this receptor may help control aberrant inflammatory responses

    • Gpr183 antagonists could potentially reduce inflammatory cytokine production in conditions characterized by excessive inflammation

  • Vaccine development:

    • Understanding Gpr183's role in vaccine responses could inform the design of more effective vaccination strategies

    • The MX2/GPR183 ratio could serve as a biomarker to predict and monitor vaccine efficacy

  • B-cell malignancies:

    • Targeting Gpr183 may enhance the efficacy of existing therapies for B-cell lymphomas and leukemias

    • Gpr183 status assessment could help stratify patients for specific therapeutic approaches

  • Targeted drug delivery:

    • Knowledge of Gpr183 expression patterns could be leveraged to develop targeted drug delivery systems specific to Gpr183-expressing cells

These potential therapeutic applications underscore the importance of continued basic and translational research on Gpr183 biology and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.