Recombinant Mouse G-protein coupled receptor 1 (Gpr1)

Shipped with Ice Packs
In Stock

Description

Metabolic Regulation

Study TypeKey FindingSource
Knockout mouse modelGpr1 deficiency exacerbates glucose intolerance in high-fat diets
Insulin secretion assaysLoss reduces glucose-stimulated insulin by 38% (p<0.05)
Pyruvate tolerance testsKO mice show 25% higher blood glucose vs WT controls

Immune Modulation

  • Binds chemerin adipokine with EC<sub>50</sub> = 18.2 nM via two-site interaction:

    • Site 1: N-terminal β-sheet interface

    • Site 2: Transmembrane pocket for C-terminal peptide (YFPGQFAFS)

  • Modulates leukocyte chemotaxis through Gi-mediated MAPK signaling

Signaling Mechanisms

Activation pathway:

  1. Chemerin binding induces conformational changes in extracellular domain

  2. Stabilizes TM3-TM6 interface through Y<sup>3.33</sup> and F<sup>6.44</sup> residues

  3. Promotes GDP-GTP exchange in Gαi subunits

Key signaling outputs:

  • Inhibits adenylyl cyclase (↓cAMP)

  • Activates PI3K-Akt and ERK1/2 pathways

  • Does not significantly couple with Gαq/11 or β-arrestin

Research Applications

  • Drug discovery: Used in Tango β-arrestin recruitment assays to screen chemerin analogs

  • Structural biology: Enabled cryo-EM studies resolving receptor-ligand complexes at 2.8-3.1 Å resolution

  • Metabolic studies: Facilitates investigation of obesity-related insulin resistance mechanisms

Experimental Considerations

Technical challenges:

  • Requires lipid nanodisc stabilization for structural studies

  • Shows rapid ligand-induced internalization (t<sub>1/2</sub> = 15-120 min)

  • Exhibits tissue-specific expression patterns:

    • High: White adipose stromal cells, skeletal muscle

    • Low: Pancreatic β-cells, liver

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipment of the format currently in stock. Should you require a specific format, please specify this in your order notes.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request; however, additional fees will apply. Please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Cmklr2; Gpr1; Chemerin-like receptor 2; Chemerin chemokine-like receptor 2; Chemokine-like receptor 2; G-protein coupled receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEVSKEMLFEELDNYSYALDYYSQESDPEEKVYLGLVHWISLFLYALAFVLGIPGNAIVI WLMGFKWKKTVTTLWFLNLAIADFIFVLFLPLYISYVALSFHWPFGLWLCKVNSFIAQLN MFSSVFFLTVISLDRYIHLLHPGLSHRHRTLKSSLVVVILVWLLASLLGGPTLYFRDTME VNNHIICYNNFQEHELTLMRHHVLTWVKFLFGYLFPLLTMSSCYLCLIFKMKKRNILISR KHLWMILSVVIAFLVCWTPYHLFSIWELSIHHNSSFQNVLQGGIPLSTGLAFLNSCLNPI LYVLISKTFQARFRASVAEVLKRSLWEASCSGTVSEQLRSAETKSLSLLETAQ
Uniprot No.

Target Background

Function
G-protein coupled receptor 1 (GPR1) is a receptor for the chemoattractant adipokine chemerin/RARRES2, suggesting a role in regulating inflammation and energy homeostasis. Signaling primarily occurs via the beta-arrestin pathway. RARRES2 binding weakly activates G proteins, calcium mobilization, and MAPK1/MAPK3 (ERK1/2) phosphorylation. GPR1 also acts as a receptor for TAFA1, mediating its effects on neuronal stem-cell proliferation and differentiation through ROCK/ERK and ROCK/STAT3 signaling pathway activation.
Gene References Into Functions
  1. GPR1 deficiency improves steroid synthesis in DHEA-hyperandrogenized mice, suggesting GPR1 as a potential therapeutic target for DHEA-induced hyperandrogenism. PMID: 29793502
  2. This research further supports the hypothesis that a functional chemerin system is crucial for maintaining healthy glucose homeostasis during obesity in mice lacking the active chemerin receptor GPR1. PMID: 24895415
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
High expressed in white adipose tissue and skeletal muscle. Expressed in hippocampus and cortex.

Q&A

What is Gpr1 and what are its primary functions in mice?

Gpr1 is a G-protein-coupled receptor expressed in metabolically active tissues in mice. It functions as an active chemerin receptor influencing glucose homeostasis during obesity. Studies with Gpr1-knockout mice demonstrate that this receptor plays a significant role in regulating glucose tolerance, especially when animals are challenged with high-fat diets . The receptor influences various metabolic pathways through ligand-binding, triggering intracellular signaling cascades that impact cell function and communication .

Methodological approach: To understand Gpr1's functions, researchers typically employ gene knockout models (Gpr1-null mice) and compare their phenotypes with wild-type counterparts under various dietary conditions. Expression analysis across tissues using RT-PCR helps identify where Gpr1 is most active.

How is Gpr1 expression distributed across mouse tissues?

Gpr1 exhibits tissue-specific expression patterns, with significant presence in metabolically active tissues. Research demonstrates that Gpr1 is expressed in skeletal muscle (both glycolytic and oxidative fibers), white adipose tissue (WAT), and brain regions including the hypothalamus and cortex . Expression levels can change in response to dietary conditions, particularly high-fat diets.

Methodological approach: Tissue expression profiles are best determined through:

  • RT-PCR analysis of isolated tissues

  • In situ hybridization for spatial localization

  • Immunohistochemistry with specific antibodies against Gpr1

  • Northern blot analysis for comparative expression levels

What is the relationship between Gpr1 and Gpa2 in signaling pathways?

While the relationship between Gpr1 and Gpa2 has been extensively studied in fungal models (particularly Candida albicans), similar signaling relationships exist in mammalian systems. In C. albicans, Gpr1 functions upstream of Gpa2 in the same signaling pathway, with the carboxyl-terminal tail of Gpr1 interacting with Gpa2 . Both proteins regulate morphogenesis through cAMP-dependent mechanisms.

Methodological approach: To study the relationship between Gpr1 and related signaling components:

  • Two-hybrid assays can confirm protein-protein interactions

  • Epistasis analysis can determine hierarchical relationships

  • Overexpression studies with wild-type and constitutively active mutants help establish functional interactions

How does Gpr1 deletion affect glucose metabolism in mice under different dietary conditions?

Gpr1 knockout has distinct metabolic consequences depending on dietary conditions. Heterozygous and homozygous Gpr1-knockout mice develop more severe glucose intolerance than wild-type mice when fed a high-fat diet, despite showing no differences in baseline conditions . The phenotype is particularly notable because:

  • Metabolic cage studies reveal that Gpr1 KO mice on high-fat diets consume significantly fewer calories (30% reduction) compared to wild-type mice

  • Despite lower caloric intake, the knockout mice still develop worse glucose intolerance

  • These effects appear dose-dependent, with heterozygous mice showing intermediate phenotypes (20% calorie reduction)

Methodological approach: To properly investigate these metabolic effects, researchers should:

  • Use age-matched cohorts of wild-type, heterozygous, and homozygous knockout mice

  • Subject groups to both low-fat and high-fat dietary interventions for extended periods (e.g., 24 weeks)

  • Perform comprehensive metabolic phenotyping including:

    • Glucose tolerance tests

    • Insulin sensitivity tests

    • Energy expenditure measurements in metabolic cages

    • Food consumption tracking (during both light and dark cycles)

    • Activity monitoring

What compensatory mechanisms occur in Gpr1-knockout mice?

Gpr1 deletion triggers compensatory changes in the expression of related signaling components. Research shows that:

  • Chemerin (Rarres2) mRNA expression increases in the hypothalamus of Gpr1 knockout mice

  • Cmklr1 (another chemerin receptor) expression decreases in both cortex and hypothalamus

  • Liver tissues show reduced Cmklr1 expression in Gpr1 knockout mice on high-fat diets

  • Soleus muscle in heterozygous mice shows reduced Cmklr1 expression on low-fat diets

These compensatory changes suggest complex regulatory networks that attempt to maintain metabolic homeostasis in the absence of functional Gpr1.

Methodological approach: To comprehensively map these compensatory mechanisms:

  • Perform comprehensive transcriptomic analysis across tissues

  • Quantify protein levels of related signaling components

  • Measure circulating ligand levels (e.g., total chemerin)

  • Create double-knockout models to test functional redundancy

How can researchers effectively quantify cAMP changes in response to Gpr1 activation?

Gpr1 signaling influences cAMP levels, as demonstrated in various model systems. In Candida albicans, both Gpr1 and Gpa2 are required for glucose-dependent increases in cellular cAMP . Similar mechanisms likely operate in mammalian systems.

Methodological approach: For accurate quantification of cAMP changes:

  • Use ELISA-based assays specific for cAMP

  • Employ real-time cAMP sensors for live-cell imaging:

    • FRET-based reporters

    • Bioluminescence resonance energy transfer (BRET) systems

  • Perform measurements under various conditions:

    • Basal state

    • After stimulation with known ligands

    • Following manipulations of the signaling pathway

  • Include appropriate controls:

    • Positive controls using forskolin (direct adenylyl cyclase activator)

    • Negative controls with phosphodiesterase inhibitors

What are the critical controls needed when studying Gpr1 function in knockout models?

When designing experiments using Gpr1 knockout models, several critical controls must be included:

Control TypePurposeImplementation
Littermate controlsAccount for genetic background variationsUse littermates from heterozygous breeding
Diet controlsDifferentiate baseline vs. diet-induced effectsInclude both standard and challenge diets (e.g., high-fat)
Temporal controlsAccount for age-related changesUse age-matched cohorts, perform longitudinal studies
Sex-specific controlsIdentify sex-dependent phenotypesInclude both male and female cohorts
Rescue experimentsConfirm phenotype causalityReintroduce wild-type Gpr1 into knockout background
Heterozygous groupsDetect gene dosage effectsInclude +/+, +/-, and -/- genotypes

Methodological approach: For rigorous knockout studies, researchers should:

  • Confirm knockout at DNA, RNA, and protein levels

  • Use littermate controls whenever possible

  • Monitor phenotypes under multiple environmental conditions

  • Consider tissue-specific conditional knockouts to avoid developmental compensation

What methods are most effective for studying Gpr1-ligand interactions?

Understanding how Gpr1 interacts with its ligands (e.g., chemerin) requires specialized approaches:

Methodological approach:

  • Binding assays using:

    • Radioligand binding with purified receptor

    • Surface plasmon resonance for binding kinetics

    • Fluorescence-based binding assays

  • Functional assays:

    • cAMP accumulation assays

    • Calcium mobilization assays

    • β-arrestin recruitment assays

  • Structural studies:

    • Cryo-electron microscopy of the receptor-ligand complex

    • Computational modeling and docking simulations

  • Mutagenesis studies to identify critical binding residues

How can researchers resolve contradictory findings regarding Gpr1 function in different tissues?

Gpr1 may exhibit different functions depending on tissue context, creating apparent contradictions in research findings.

Methodological approach to resolving contradictions:

  • Perform tissue-specific conditional knockout studies

  • Analyze tissue-specific expression levels and splice variants

  • Consider temporal dynamics of signaling

  • Evaluate the influence of:

    • Different ligand concentrations

    • Presence of co-receptors or modulatory proteins

    • Metabolic state of the tissue

  • Use systems biology approaches to model context-dependent functions

What technical challenges exist in differentiating Gpr1 effects from other chemerin receptors?

Chemerin can signal through multiple receptors (Gpr1, Cmklr1), creating challenges in attributing specific biological effects.

Methodological approach:

  • Use receptor-specific antagonists when available

  • Employ siRNA or shRNA approaches targeting specific receptors

  • Create cell lines expressing single receptor types

  • Develop receptor-specific activation assays

  • Utilize double knockout models to eliminate compensatory mechanisms

How might novel Gpr1 ligands be identified for research applications?

Identifying novel Gpr1 ligands could advance understanding of its biological functions.

Methodological approach:

  • High-throughput screening approaches:

    • Cell-based reporter assays

    • Binding competition assays

    • Fragment-based drug discovery

  • In silico screening:

    • Molecular docking simulations

    • Pharmacophore modeling

    • Structure-based virtual screening

  • Deorphanization strategies:

    • Tissue extract fractionation

    • Metabolomics approaches to identify endogenous ligands

  • Chemical biology approaches:

    • Photoaffinity labeling

    • Activity-based protein profiling

What emerging technologies will advance our understanding of Gpr1 signaling dynamics?

Emerging technologies promise to reveal new aspects of Gpr1 biology.

Methodological approach:

  • CRISPR-based approaches:

    • Precise genome editing to create mutation libraries

    • CRISPRa/CRISPRi for endogenous expression modulation

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell-specific expression patterns

    • Single-cell metabolomics to track metabolic consequences

  • Advanced imaging techniques:

    • Super-resolution microscopy to track receptor localization

    • Optogenetic control of receptor activation

  • Spatial transcriptomics to map receptor expression in intact tissues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.