Recombinant Mouse G-protein coupled receptor 20 (Gpr20)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include this information in your order remarks. We will then prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag according to your requirements.
Synonyms
Gpr20; G-protein coupled receptor 20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MPSALSMRPWDAALPNTTAAAWTNGSVPEMPLFHHFARLDEELQATFPSLWQALMVVHGT IFLAGLVLNGLALYVFCCRTRAKTPSVTYTINLVVTDLLVGLSLPTRFAVFYGARGCLRC AFPHVLGYFLNMHCSILFLTCICVDRYLAIVQPEGSRRWRQPACAKAVCIFVWLAAGVVT LSVLGVKSGGRSCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQ LLLTVLVIFLVCFTPFHARQVAVALWPNVPKHTSLVAYHVAVTLSSLNSCMDPIVYCFIT SGFQATVRGLFYQRGEEFKPSSMDVVSMHKSTKASAPIHILSIGSHTLTQPLTNGPEP
Uniprot No.

Target Background

Function
Orphan receptor with constitutive G(i) signaling activity that activates cyclic AMP.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous expressed with abundant expression in intestinal tissues.

Q&A

What is GPR20 and what are its primary functional characteristics?

GPR20 is a class-A orphan G protein-coupled receptor that constitutively activates Gi proteins in the absence of any known ligand. Bioluminescence resonance energy transfer (BRET) assays have confirmed this unique Gi activity, showing reduced BRET signal compared to negative controls including empty vector (mock control) and the adenosine A2A receptor . GPR20 demonstrates comparable BRET signal to the apelin receptor (APJ) in the presence of an agonist, confirming its constitutive activity . Structurally, GPR20 features a uniquely folded N-terminal helix capping the transmembrane domain, which plays a critical role in stimulating its basal activity .

What expression systems are used for producing recombinant mouse GPR20?

Recombinant mouse GPR20 (UniProt No. Q8BYC4) is typically produced in yeast expression systems, which provide appropriate eukaryotic post-translational modifications important for GPCR functionality . Production in yeast systems yields protein with greater than 85% purity as determined by SDS-PAGE analysis . For structural studies of human GPR20, researchers have developed strategies to obtain stable GPR20-Gi complex samples amenable for structural investigation by cryo-EM, though the specific expression systems for these complexes vary based on experimental requirements .

What are the optimal storage conditions for recombinant GPR20 protein?

The stability of recombinant mouse GPR20 is influenced by multiple factors including storage state, buffer composition, temperature, and the intrinsic stability of the protein itself . For liquid formulations, the recommended shelf life is approximately 6 months when stored at -20°C/-80°C . Lyophilized preparations demonstrate extended stability, with a shelf life of up to 12 months at -20°C/-80°C . To maintain protein integrity, repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for a maximum of one week .

What reconstitution protocols are recommended for lyophilized GPR20?

For optimal reconstitution of lyophilized mouse GPR20 protein:

  • Briefly centrifuge the vial prior to opening to ensure all contents settle at the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation)

  • Prepare small aliquots to minimize freeze-thaw cycles

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage

This protocol helps maintain protein stability and reduces activity loss during storage.

How is GPR20 expression typically detected in tissue samples?

Immunohistochemistry (IHC) is the primary method for detecting GPR20 expression in tissue samples. Researchers have utilized several antibodies including rabbit anti-GPR20 antibody 04-093OcH1L1 and rat anti-GPR20 antibody 04-093 for GPR20 detection in gastrointestinal stromal tumor (GIST) samples . Expression is typically scored on a scale from 0 to 3+, with studies showing GPR20 expression in approximately 91% of GIST samples from Dana-Farber Cancer Institute and 88% of samples from National Cancer Center Hospital East in Japan . GPR20 and KIT expression show a significant positive correlation in GIST specimens, with GPR20 expression detected in 97% of samples with strong KIT positivity .

What molecular mechanisms enable GPR20's high basal activity in the absence of ligands?

The constitutive activity of GPR20 appears to stem from multiple structural elements:

  • N-terminal cap region: Cryo-EM structures reveal a uniquely folded N-terminal helix that caps onto the transmembrane domain. Mutagenesis studies indicate this cap region plays a crucial role in stimulating the basal activity of GPR20 .

  • Orthosteric pocket occupancy: Structural studies have identified an unassigned density in the orthosteric pocket of GPR20, which may contribute to its constitutive activity .

  • Transmembrane configuration: Unlike some orphan receptors where additional densities attributable to unknown ligands are detected, GPR20's transmembrane pocket appears to maintain an activity-conducive conformation independently .

BRET assays measuring G-protein heterotrimer dissociation confirm that ligand-free GPR20 exhibits Gi activity comparable to agonist-stimulated receptors known to couple with Gi proteins . This constitutive activity mechanism makes GPR20 particularly interesting among orphan GPCRs and suggests unique approaches may be needed for developing modulators.

What experimental approaches are most effective for studying GPR20-antibody interactions?

Several approaches have proven effective for studying GPR20-antibody interactions:

  • Structural characterization: Cryo-EM has successfully revealed the molecular interactions between GPR20 and antibodies such as Ab046, providing atomic-level details of binding interfaces .

  • Co-expression systems: For complex formation between GPR20 and antibody fragments, co-expression in insect cells has been effectively employed in studies of similar GPCRs .

  • Binding validation: Fluorescence-activated cell sorting (FACS) assays can quantify antibody binding to GPCR extracellular domains and determine EC50 values .

  • Mutagenesis studies: Site-directed mutagenesis of residues involved in hydrogen bonding and other key interactions can validate structural findings and identify critical binding determinants .

These approaches have enabled the development of GPR20-targeting antibody-drug conjugates currently in clinical trials for GIST treatment, such as DS-6157a containing a GPR20-binding antibody .

How is GPR20 expression regulated in normal tissues and disease states?

GPR20 expression is regulated through specific transcriptional mechanisms and varies significantly between tissue types:

  • Transcriptional regulation: Expression is controlled by Forkhead box F1 (FOXF1) and ETS variant transcription factor 1 (ETV1), transcription factors critical for GIST initiation, proliferation, and survival .

  • Tissue-specific expression: In mice, GPR20 is expressed in subsets of interstitial cells of Cajal (ICC) . In human tissues, expression patterns vary with particularly high expression in gastrointestinal tissues affected by GIST.

  • Variation by tumor location: Higher GPR20 expression is observed in small intestinal GIST compared to gastric GIST, with 94% of small intestinal GIST samples showing strong GPR20 positivity versus 34% of gastric GIST samples .

  • Mutation association: GPR20 expression levels correlate with specific KIT mutations in GIST. For example, GPR20 expression is higher in tumors with KIT exon 9 mutations (100% expression, 96% with IHC score 3+) compared to those with KIT exon 11 mutations (77% expression, 20% with IHC score 3+) .

  • Treatment effects: Strong GPR20 positivity increases in GISTs that have progressed through multiple lines of treatment, with 26% positivity in treatment-naïve samples compared to 71% in samples after third-line treatment .

These patterns suggest complex regulatory mechanisms and potential roles in disease progression and treatment response.

What are the key structural features of GPR20 revealed by recent cryo-EM studies?

Recent cryo-EM studies have provided significant insights into GPR20 structure:

  • Multiple conformational states: Three key structures have been determined: Gi-coupled GPR20 without a ligand, Gi-coupled GPR20 with the Fab fragment of Ab046, and Gi-free GPR20 .

  • N-terminal helix cap: A uniquely folded N-terminal helix caps onto the transmembrane domain, distinguishing GPR20 from many other GPCRs and contributing to its constitutive activity .

  • Orthosteric pocket: The orthosteric pocket contains an unassigned density that may be significant for deorphanization efforts .

  • Antibody binding interface: Structural studies reveal the molecular interactions between GPR20 and antibodies such as Ab046, which primarily engage with the extracellular regions of the receptor .

  • Transmembrane arrangement: The transmembrane region forms a shallow pocket that adopts an inactive-like conformation in the absence of G proteins, providing insights into the receptor's activation mechanisms .

These structural features provide a foundation for understanding GPR20 function and developing targeted therapeutics.

What experimental models are available for studying GPR20 in the context of gastrointestinal stromal tumors?

Several experimental models have been established for studying GPR20 in GIST:

  • Clinical sample collections: Characterized GIST sample collections from multiple institutes, including Dana-Farber Cancer Institute (DFCI, n=139) and National Cancer Center Hospital East, Japan (NCCHE, n=100), provide resources for GPR20 expression studies .

  • Cell lines: GIST cell lines with varying levels of GPR20 expression offer in vitro models for functional studies .

  • Patient-derived xenografts (PDX): PDX models maintain the cellular and molecular characteristics of original tumors and can be used to assess GPR20-targeted therapeutic approaches .

  • TKI-resistant models: GIST xenograft models resistant to tyrosine kinase inhibitors (imatinib, sunitinib, and regorafenib) enable testing of GPR20-targeted therapies in the context of treatment resistance .

  • Tissue microarrays (TMA): Commercially available GIST TMAs facilitate high-throughput analysis of GPR20 expression patterns across multiple samples .

These models have supported the development of GPR20-targeted therapies such as the antibody-drug conjugate DS-6157a, which has demonstrated GPR20 expression-dependent antitumor activity in GIST xenograft models .

What approaches can be used to identify potential ligands for orphan GPR20?

Deorphanizing GPR20 remains challenging but several approaches show promise:

  • Structural analysis: The cryo-EM structures revealing an unassigned density in the orthosteric pocket provide starting points for virtual screening of potential ligands .

  • Comparative pharmacology: Analysis of the transmembrane pocket of GPR20 compared to structurally similar GPCRs with known ligands may guide the identification of ligand candidates .

  • Activity-based screening: Given GPR20's constitutive activity, screens for compounds that modulate this basal activity (particularly inhibitors) may identify interacting molecules .

  • Expression correlation analysis: Identifying molecules whose expression patterns correlate with GPR20 in tissues where it is functionally active could suggest potential endogenous ligands .

  • Mutagenesis studies: Systematic mutagenesis of residues in the orthosteric pocket, coupled with activity assays, may help characterize the binding requirements for potential ligands .

While the search for GPR20 ligands continues, these approaches provide pathways toward potential deorphanization.

What are the critical considerations for purifying GPR20 for structural and functional studies?

Successful purification of GPR20 for structural and functional studies requires attention to several factors:

  • Expression system selection: Yeast expression systems have proven effective for recombinant mouse GPR20 production, yielding protein with >85% purity by SDS-PAGE .

  • Complex stabilization: For structural studies of GPR20-Gi complexes, specialized strategies are needed to obtain stable samples amenable for cryo-EM investigation .

  • Antibody co-purification: For GPR20-antibody complex studies, co-expression of antibody and receptor in insect cells or incubation of purified components have been successfully employed with similar GPCRs .

  • Storage conditions: Maintaining purified GPR20 requires careful consideration of buffer composition, glycerol concentration (5-50%), and storage temperature (-20°C/-80°C) .

  • Detergent selection: As with other membrane proteins, the choice of detergents for extraction and purification significantly impacts GPR20 stability and functionality.

These considerations are essential for obtaining high-quality GPR20 preparations suitable for downstream structural and functional analyses.

How does GPR20 expression pattern correlate with genetic mutations in GIST?

Analysis of GPR20 expression in GIST samples reveals significant correlations with genetic mutations:

Mutation TypeGPR20 ExpressionStrong Positivity (3+)
KIT exon 9100%96%
KIT exon 1177%20%
KIT exon 13/17PresentVariable
PDGFRA mutantLower than KITLower than KIT

GPR20 is expressed in both GISTs harboring primary mutations and those with primary and secondary mutations in KIT . It maintains expression in samples with KIT mutations associated with tyrosine kinase inhibitor resistance (exons 13/14 and 17) . This consistent expression across mutation types makes GPR20 an attractive target for therapeutics that may overcome resistance to conventional treatments.

What is the potential of GPR20 as a therapeutic target in GIST?

GPR20 shows significant promise as a therapeutic target in GIST for several reasons:

  • Differential expression: GPR20 is differentially and highly expressed in GIST compared to normal tissues .

  • Expression persistence: GPR20 expression is maintained or even increased in tumors that have progressed through multiple lines of tyrosine kinase inhibitor (TKI) treatment .

  • Targeted therapeutic development: An antibody-drug conjugate (ADC) containing a GPR20-binding antibody (Ab046) has been developed and is in clinical trials for GIST treatment .

  • Preclinical efficacy: The anti-GPR20 ADC DS-6157a has demonstrated GPR20 expression-dependent antitumor activity in GIST xenograft models, including those resistant to standard TKIs (imatinib, sunitinib, and regorafenib) .

  • Structural insights: Detailed understanding of GPR20 structure and antibody binding modes enables the design of improved targeting strategies with enhanced affinity or novel functionalities .

These characteristics position GPR20 as a promising alternative therapeutic target, particularly for GIST patients who have developed resistance to conventional TKI treatments.

How do mouse and human GPR20 compare in terms of structure and function?

While the search results provide limited direct comparison between mouse and human GPR20, several key points can be inferred:

  • Conservation: Mouse GPR20 (UniProt: Q8BYC4) and human GPR20 share significant sequence homology as expected for orthologous GPCRs .

  • Expression patterns: In mice, GPR20 is expressed in subsets of interstitial cells of Cajal (ICC), suggesting potential developmental or physiological roles similar to those in humans .

  • Structural features: The unique N-terminal helix cap identified in human GPR20 structures is likely conserved in mouse GPR20, given its functional importance .

  • Research applications: Recombinant mouse GPR20 is produced for research applications, enabling comparative studies between species and investigation of conserved mechanisms .

  • Model relevance: Studies of mouse GPR20 can inform understanding of human GPR20 biology, though species-specific differences should be considered in translational research.

Further comparative studies between mouse and human GPR20 would enhance understanding of conserved mechanisms and species-specific differences relevant to both basic biology and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.