Recombinant Mouse G-protein coupled receptor 26 (Gpr26)

Shipped with Ice Packs
In Stock

Description

Definition and Production of Recombinant Mouse GPR26

Recombinant mouse GPR26 refers to the engineered production of the GPR26 protein in heterologous systems (e.g., E. coli, yeast, baculovirus, or mammalian cells). This approach enables the study of its structure, function, and potential therapeutic applications.

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells .
Purity≥85% as determined by SDS-PAGE .
Gene LocationChromosome 7 F3 in mice .
Amino Acid Length337 residues (identical to human GPR26) .

GPR26 lacks a known endogenous ligand, and its recombinant form is used to study ligand-independent (constitutive) signaling pathways .

Functional Insights

MechanismOutcome
Constitutive Gαs couplingIncreased cAMP levels in HEK293 cells .
CREB phosphorylationReduced phosphorylated CREB (pCREB) in the central amygdala of GPR26 KO mice .
AMPK activationElevated AMPK phosphorylation at Ser172 in GPR26-deficient mice, linked to hyperphagia and obesity .

Energy Homeostasis and Obesity

  • GPR26 knockout mice exhibit hyperphagia, reduced energy expenditure, and diet-induced obesity due to AMPK pathway dysregulation .

  • Rimonabant hypersensitivity: GPR26-deficient mice show enhanced weight loss in response to CB1 receptor antagonists, suggesting a potential therapeutic target for obesity .

Neurodegeneration and Mental Health

  • Anxiety and depression: GPR26 KO mice display increased anxiety-like behaviors in open-field tests and elevated plus mazes .

  • Role in CREB signaling: Reduced pCREB in the central amygdala correlates with emotional dysregulation .

Metabolic Disorders and Hyperglycemia

  • Protective role in monocytes: GPR26 counteracts oxidative stress and inflammation under acute hyperglycemia but is downregulated chronically in diabetic patients .

  • Monocyte adhesion: GPR26 knockdown exacerbates NF-κB activation and monocyte-endothelial cell adhesion, a hallmark of atherosclerosis .

Recombinant GPR26 in Functional Studies

AssayPurpose
cAMP productionQuantify Gαs coupling activity .
ROS measurementEvaluate oxidative stress in monocytes (e.g., DCFH-DA fluorescence) .
Western blottingDetect phosphorylated CREB or AMPK in brain tissue .

Knockout Models

  • GPR26 KO mice: Used to study obesity, anxiety, and metabolic phenotypes .

Challenges and Future Directions

  • Ligand discovery: Identifying endogenous or synthetic ligands for GPR26 remains a priority .

  • Therapeutic potential: Targeting GPR26 with monoclonal antibodies or small-molecule agonists may address obesity, diabetes, and neurodegenerative diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us and we will prioritize its inclusion in the manufacturing process.
Synonyms
Gpr26; G-protein coupled receptor 26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MNSWDAGLAGLLVGTIGVSLLSNGLVLLCLLHSADIRRQAPALFTLNLTCGNLLCTVVNM PLTLAGVVAQRQPAGDRLCRLAAFLDTFLAANSMLSMAALSIDRWVAVVFPLSYRAKMRL RDAAFMVAYTWLHALTFPATALALSWLGFHQLYASCTLCSRRPDERLRFAVFTSAFHALS FLLSFIVLCFTYLKVLKVARFHCKRIDVITMQTLVLLVDIHPSVRERCLEEQKRRRQRAT KKISTFIGTFLVCFAPYVITRLVELFSTAPIGSHWGVLSKCLAYSKAASDPFVYSLLRHQ YRRSCKELLNRIFNRRSLHSVGLTGDSHSQNILPVSE
Uniprot No.

Target Background

Function
Gpr26 is an orphan receptor that exhibits a significant level of constitutive activity. Its effect is mediated by G(s)-alpha protein, which stimulates adenylate cyclase, leading to an elevation in intracellular cAMP.
Gene References Into Functions
  1. Data suggests that Gpr26 plays a crucial role in emotion regulation in mice, likely mediated by the phosphorylation of CREB in the central amygdala. PMID: 21924326
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Exclusively expressed in the brain. Prominent expression is detected throughout the entire neocortex at all rostrocaudal and dorsoventral levels. Strong expression is detected in olfactory and auditory sensory areas.

Q&A

What is GPR26 and where is it primarily expressed?

GPR26 is a brain-specific orphan G-protein coupled receptor with no identified endogenous ligand. It shows abundant expression in brain regions associated with appetite control, particularly the hypothalamus . Additional expression is observed in the hippocampal CA1 region (specifically in the deep sublayer near stratum oriens) and sparse expression in other brain regions including layer V cortex and thalamus . GPR26 bears structural similarities to the 5-hydroxytryptamine receptor 5A and gastrin-releasing hormone BB2 receptor, suggesting a potential role in regulating energy metabolism . The human GPR26 gene has been mapped to an obesity locus on chromosome 10q26, providing further evidence for its metabolic functions .

What are the primary phenotypes of GPR26 knockout mice?

GPR26 knockout mice exhibit several distinct phenotypes related to metabolism and behavior:

  • Metabolic phenotypes:

    • Hyperphagia (increased food intake)

    • Hypometabolism (decreased energy expenditure)

    • Early onset of diet-induced obesity

    • Glucose intolerance

    • Hyperinsulinemia

    • Dyslipidemia

  • Hormonal changes:

    • Increased serum insulin levels

    • Decreased circulating ghrelin levels

    • Elevated serum leptin levels, particularly in female mice

  • Neurological/behavioral phenotypes:

    • Increased anxiety and depression

    • Hypersensitivity to rimonabant (an endocannabinoid receptor-1 antagonist)

The metabolic defects are more pronounced in female GPR26 knockout mice, indicating sex-specific differences in GPR26 function .

How does GPR26 regulate energy homeostasis?

GPR26 appears to regulate energy homeostasis through multiple mechanisms:

  • AMPK signaling pathway: GPR26 deficiency significantly increases hypothalamic AMPK phosphorylation at Ser172, a major activation site implicated in hyperphagia and obesity onset . This suggests that GPR26 normally functions to inhibit AMPK activation, thereby suppressing appetite.

  • Interaction with endocannabinoid system: GPR26 knockout mice show hypersensitivity to treatment with rimonabant, an endocannabinoid receptor-1 antagonist used to treat obesity by suppressing appetite . GPR26 exhibits striking similarity in mRNA expression pattern with that of CB1 receptor, suggesting potential functional interaction .

  • Hormonal regulation: GPR26 deficiency alters levels of metabolic hormones including insulin, ghrelin, and leptin, which collectively contribute to energy balance dysregulation .

What challenges exist when using Gpr26-Cre driver lines?

A significant challenge when using Gpr26-Cre driver lines is germline recombination. Unlike many Cre lines where maternal transmission carries risk of germline recombination, Gpr26-Cre shows selective paternal germline recombination . When male Rosa26; Gpr26-Cre mice were crossed with wild-type females, 27.6% (8/29) of offspring with the transgene had only a recombined allele regardless of Cre presence, indicating germline recombination . In contrast, when Cre was transmitted through the female parent, the loxP-stop-loxP sequences remained largely intact .

This paternal germline recombination pattern is contrary to the general recommendation of using Cre-positive males for breeding to avoid germline deletion. Researchers should be aware of this unique characteristic when designing breeding strategies for experiments involving Gpr26-Cre mice.

How does the recombination pattern in Gpr26-Cre mice affect experimental design?

The recombination pattern in Gpr26-Cre mice has several implications for experimental design:

  • Breeding strategy: Female Gpr26-Cre mice should be used for transmitting Cre to offspring to avoid germline recombination .

  • Reporter expression pattern: In mice without germline recombination, Gpr26-Cre drives reporter expression (e.g., EYFP-ChR2) prominently in the hippocampal CA1 region with weak expression in the cortex . Specifically, within CA1, expression is restricted to the deep sublayer near stratum oriens .

  • Verification of intended recombination: Due to the risk of germline recombination, it is essential to verify that recombination has occurred only in the intended cell populations. This can be accomplished by comparing expression patterns between animals with and without germline recombination .

  • Target locus considerations: Different floxed loci may show different recombination efficiencies. Therefore, researchers should not rely on reporter data alone as proxy for recombination at their locus of interest .

What molecular mechanisms link GPR26 to obesity and metabolic disorders?

The molecular pathways connecting GPR26 to energy metabolism involve several key components:

  • AMPK activation: GPR26 deficiency significantly increases phosphorylation of AMPK at Ser172 in the hypothalamus . Activated AMPK is a major driver of hyperphagia and obesity onset through its effects on hypothalamic neurons controlling appetite.

  • Endocannabinoid system interaction: GPR26 knockout mice show hypersensitivity to the appetite-suppressing effects of rimonabant, suggesting crosstalk between GPR26 and CB1 receptor signaling pathways . This is further supported by the similar expression patterns of GPR26 and CB1 receptor mRNAs in the brain .

  • Metabolic hormone dysregulation:

    • Increased insulin levels contributing to insulin resistance

    • Decreased ghrelin levels, consistent with the obesity phenotype

    • Elevated leptin levels in female mice, suggesting leptin resistance

These mechanisms collectively contribute to the hyperphagia, reduced energy expenditure, and subsequent obesity observed in GPR26 knockout mice.

What are the optimal approaches for targeting GPR26-expressing neurons?

Based on experimental protocols described in the literature, the following approaches have been successful for targeting GPR26-expressing neurons:

  • Viral vector delivery: AAV-mediated gene delivery has been used successfully in Gpr26-Cre mice. Specifically:

    • AAV1.Syn.Flex.GCaMP6s.WPRE.SV40 has been used for calcium imaging

    • Stereotaxic coordinates for targeting GPR26-expressing neurons in the thalamus (POm): 1.8 mm posterior to bregma and 1.25 mm from midline

  • Surgical procedures:

    • Initial anesthesia with isoflurane (1-2.5% in O₂ vol/vol) followed by ketamine/xylazine (75/10 mg/kg) administered intraperitoneally

    • Lidocaine (1% wt/vol) injected around the surgical site

    • Body temperature maintained at ~36°C

    • Small craniotomy (~0.5 × 0.5 mm²) made above the target region

    • Viral construct backloaded into a glass micropipette and slowly injected (20 ml/min, total amount 40-50 nl)

    • Pipette left in place for 2-5 minutes after injection

  • Electrophysiological recording:

    • Linear array of 16 electrodes (NeuroNexus, A1×16-3 mm-50-177-A16) or glass pipette inserted into the area

    • Electrical activity bandpass-filtered at 1-9 kHz and digitized at 10 kHz

How should researchers design metabolic studies with GPR26 knockout mice?

When designing metabolic studies using GPR26 knockout mice, researchers should consider:

  • Sex-specific effects: The metabolic phenotype is more pronounced in female mice, so both sexes should be analyzed separately .

  • Diet considerations: Use high-fat diet to accelerate the development of the obese phenotype, as GPR26 knockout mice show early onset of diet-induced obesity .

  • Key metabolic parameters to measure:

    • Food intake (to assess hyperphagia)

    • Energy expenditure using metabolic chambers

    • Body weight and composition (lean vs. fat mass)

    • Glucose tolerance tests

    • Insulin sensitivity tests

    • Serum insulin, ghrelin, and leptin levels

  • Molecular analyses:

    • AMPK phosphorylation status in the hypothalamus

    • Expression of appetite-regulating neuropeptides

    • Lipid profiles to assess dyslipidemia

What genotyping strategies are recommended for GPR26 mutant mice?

Effective genotyping strategies for GPR26 mutant mice should include:

  • For Gpr26-Cre lines:

    • PCR with primers specific for the Cre recombinase gene

    • Careful verification of germline recombination status, especially in offspring from male Cre carriers

  • For floxed alleles:

    • Use primer sets that can distinguish between the floxed allele before and after recombination

    • For example, with Rosa26 reporter lines, design primers where the forward primer anneals to the stop cassette that would be deleted by Cre recombinase

    • This approach allows detection of both the original allele (LSL-tg) and the recombined allele (L-tg)

  • Verification of tissue-specific recombination:

    • Compare recombination in target tissues versus non-target tissues

    • Include controls from both Cre-negative and Cre-positive animals to identify unexpected recombination

How should researchers account for germline recombination in their data analysis?

When analyzing data from experiments using Gpr26-Cre mice, researchers should implement these strategies to account for germline recombination:

  • Genotyping verification: Always perform genotyping that can detect both the original floxed allele and the recombined allele in all experimental animals .

  • Control selection: Include littermates with the same genotype at the floxed locus but without Cre as controls, and verify absence of recombination in these controls .

  • Expression pattern analysis: Compare the expression pattern of fluorescent reporters or other markers between animals with intended recombination versus germline recombination:

    • In mice with intended recombination only, GPR26-driven Cre expression produces reporter signal prominently in the CA1 region with weak cortical expression

    • In mice with germline recombination, reporter expression will be global and present in all cell types

  • Data exclusion criteria: Establish clear criteria for excluding data from animals with unexpected recombination patterns that could confound results .

What are the potential confounding factors when studying GPR26 function?

Several confounding factors should be considered when studying GPR26 function:

  • Sex-dependent effects: The metabolic phenotypes in GPR26 knockout mice show sex bias, with more pronounced effects in females . This necessitates sex-stratified analyses.

  • Germline recombination: When using Gpr26-Cre driver lines, germline recombination can occur at rates of approximately 27.6% when Cre is transmitted paternally . This can result in global rather than cell type-specific gene manipulation.

  • Target locus variability: Different floxed loci may show different susceptibilities to Cre-mediated recombination, so recombination at one locus (e.g., a reporter) is not a reliable proxy for recombination at another locus of interest .

  • Developmental compensations: As an orphan receptor involved in energy homeostasis, loss of GPR26 function may trigger compensatory mechanisms that could mask or exaggerate phenotypes.

  • Anxiety and depression phenotypes: GPR26 deficiency is also associated with increased anxiety and depression , which could indirectly affect feeding behavior and metabolism, potentially confounding the interpretation of metabolic phenotypes.

What are promising approaches for identifying GPR26 ligands?

As an orphan receptor, identifying the endogenous ligand(s) for GPR26 remains a critical research goal. Promising approaches include:

  • Screening compounds for GPR26 activation:

    • High-throughput screening of compound libraries against cells expressing recombinant GPR26

    • Measurement of second messenger responses (cAMP, Ca²⁺, etc.)

    • Bias signaling assays to detect different signaling pathways

  • Tissue extract fractionation:

    • Preparation of extracts from brain regions with high GPR26 expression

    • Biochemical fractionation of these extracts

    • Testing fractions for GPR26 activation

    • Mass spectrometry identification of compounds in active fractions

  • In silico modeling and virtual screening:

    • Homology modeling of GPR26 structure based on related GPCRs

    • Virtual screening of compound libraries against the modeled binding pocket

    • Experimental validation of predicted ligands

How might GPR26 be targeted therapeutically for obesity and metabolic disorders?

The research suggests several therapeutic approaches targeting GPR26:

  • Development of GPR26 agonists: Since GPR26 deficiency leads to hyperphagia and obesity, agonists that activate GPR26 could potentially suppress appetite and increase energy expenditure .

  • Combination with endocannabinoid system modulators: Given the apparent interaction between GPR26 and the endocannabinoid system, combination therapies might provide synergistic effects . GPR26 activators might address obesity without the psychiatric side effects seen with rimonabant (increased anxiety, depression, and suicidal ideation) .

  • Targeting downstream signaling pathways: Inhibitors of AMPK activation in GPR26-expressing neurons could potentially bypass the need for direct GPR26 activation .

  • Sex-specific therapeutic approaches: Given the more pronounced metabolic effects in females, sex-specific dosing or formulations might be considered for optimal efficacy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.