Recombinant Mouse G-protein coupled receptor 39 (Gpr39)

Shipped with Ice Packs
In Stock

Description

Functional Insights from Rodent Models

Recent studies using recombinant Gpr39 highlight its role in spinal pain circuits and synaptic regulation:

Mechanical Pain Modulation

  • Gpr39 maintains glycinergic inhibition in somatostatin-positive (SOM⁺) spinal interneurons. Knockdown reduces GlyR-mediated inhibitory currents, increasing mechanical pain sensitivity .

  • Key Data:

    • AP Firing Frequency: ↑ 40% in Gpr39-deficient SOM⁺ neurons

    • Mechanical Allodynia: Von Frey thresholds ↓ 60% in knockdown mice

Signaling Mechanisms

  • Interacts with glycine receptors (GlyRs) independent of G-proteins to stabilize inhibitory synapses .

  • Modulates ERK/MAPK and PI3K/AKT pathways in epithelial repair .

Methodological Protocols

  • Antibody Validation: Proteintech’s GPR39 antibody (23326-1-AP) is validated for IHC and WB in murine tissues .

  • Functional Assays:

    • GlyR-mIPSC recordings to assess synaptic inhibition .

    • Calcium imaging for Zn²⁺-induced signaling .

Therapeutic Potential

Pharmacological activation of Gpr39 in murine models:

  • TC-G 1008 (Gpr39 agonist) reduces inflammatory mechanical pain by 70% .

  • Enhances cytoprotective PEDF secretion under oxidative stress .

Unresolved Questions

  • Ligand Specificity: While Zn²⁺ is a primary agonist, obestatin’s role remains debated .

  • Tissue-Specific Isoforms: Partial recombinant constructs may lack critical domains for full functional studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Gpr39; G-protein coupled receptor 39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MASSSGSNHICSRVIDHSHVPEFEVATWIKITLILVYLIIFVVGILGNSVTIRVTQVLQK KGYLQKEVTDHMVSLACSDILVFLIGMPMEFYSIIWNPLTTPSYALSCKLHTFLFETCSY ATLLHVLTLSFERYIAICHPFKYKAVSGPRQVKLLIGFVWVTSALVALPLLFAMGIEYPL VNVPTHKGLNCNLSRTRHHDEPGNSNMSICTNLSNRWEVFQSSIFGAFAVYLVVLASVAF MCWNMMKVLMKSKQGTLAGTGPQLQLRKSESEESRTARRQTIIFLRLIVVTLAVCWMPNQ IRRIMAAAKPKHDWTRTYFRAYMILLPFSDTFFYLSSVVNPLLYNVSSQQFRKVFWQVLC CRLTLQHANQEKRQRARFISTKDSTSSARSPLIFLASRRSNSSSRRTNKVFLSTFQTEAK PGEAKPQPLSPESPQTGSETKPAGSTTENSLQEQEV
Uniprot No.

Target Background

Function

Zn2+ acts as an agonist. This receptor mediates its action through G protein coupling, activating a phosphatidylinositol-calcium second messenger system. Its effects are primarily mediated by Gqα and G12/G13 proteins. GPR39 is involved in the regulation of body weight, gastrointestinal motility, hormone secretion, and cell death.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expression is detected in septumamygdala, parietal cells, enterocytes, neurons and pancreas, in peripheral organs such as the duodenum and kidney but not in the pituitary and hypothalamus.

Q&A

What is GPR39 and how is it classified?

GPR39 is a rhodopsin-type G-protein-coupled receptor (GPCR) belonging to the ghrelin receptor family . It mediates its action through association with G proteins that activate a phosphatidylinositol-calcium second messenger system, with effects primarily mediated through G(q)-alpha and G(12)/G(13) proteins . Originally considered an orphan receptor (a receptor without defined ligands), GPR39 has now been identified as responding to specific molecular signals, particularly zinc ions (Zn²⁺) and certain bile acids .

The receptor is encoded by the GPR39 gene, which in humans is identified by the entrez gene ID 2863 . GPR39 is evolutionarily conserved, with the human version showing partial sequence identity with mouse and rat orthologs (approximately 55% in some regions) . This conservation suggests the fundamental physiological importance of this receptor across mammalian species.

What are the primary physiological roles of GPR39?

GPR39 has been implicated in multiple physiological processes across different body systems. Research indicates its involvement in:

  • Regulation of body weight and gastrointestinal mobility, potentially through its relationship with the ghrelin signaling pathway .

  • Hormone secretion, particularly insulin release from pancreatic β-cells, which becomes evident under conditions of increased metabolic demand .

  • Cell death regulation, though the specific mechanisms remain under investigation .

  • Zinc-dependent signaling in epithelial tissues, including the intestines, prostate, and salivary glands .

  • Modulation of pain processing in the spinal cord through interaction with glycine receptors .

  • Regulation of responses to hypertensive stimuli, with implications for blood pressure control .

These diverse functions highlight GPR39 as a significant molecular target with potential therapeutic applications across multiple disease states, including diabetes, hypertension, and inflammatory pain conditions .

How does recombinant mouse GPR39 differ from human GPR39?

Recombinant mouse GPR39 shares significant structural homology with human GPR39, but with notable sequence variations. The recombinant human GPR39 fragment (aa 367-443) shows approximately 55% sequence identity with mouse and rat orthologs in that specific region . These differences may account for species-specific responses to ligands and pathway activation.

Functional studies suggest that while both human and mouse GPR39 respond to similar ligands including zinc and certain bile acids, there may be differences in their signaling efficiency and physiological roles . Evolutionary analysis indicates that GPR39 first developed the ability to respond to bile acids before the mammalian version additionally gained responsiveness to zinc ions, suggesting an evolutionary adaptation in the receptor's function .

When designing experiments, researchers should be aware that findings from mouse models may not translate directly to human systems due to these molecular differences. Cross-species validation is recommended when extrapolating findings from recombinant mouse GPR39 studies to human applications.

Where is GPR39 primarily expressed and how does this relate to its functions?

GPR39 exhibits a tissue-specific expression pattern that correlates with its diverse physiological functions. The receptor is predominantly expressed in:

  • Gastrointestinal tract, where it may regulate gut motility and digestive functions .

  • Liver, potentially influencing metabolic processes and bile acid signaling .

  • Adipose tissue, suggesting a role in adipogenesis and fat metabolism .

  • Pancreas, particularly in β-cells, where it modulates insulin secretion .

  • Central nervous system and spinal cord, where it regulates pain processing through interactions with glycinergic inhibitory interneurons .

  • Vascular system, including the aorta, where expression increases under hypertensive conditions .

The expression pattern of GPR39 can be altered under pathological conditions. For example, upregulation of GPR39 has been observed in the aorta of hypertensive patients and mouse models of hypertension, suggesting its potential involvement in vascular dysfunction . Similarly, its expression in pancreatic tissue appears to be physiologically significant for maintaining insulin secretion under metabolically demanding conditions such as aging or high-fat diet consumption .

What signaling pathways does GPR39 activate and how do they differ across tissues?

GPR39 engages multiple signaling cascades that vary depending on the tissue context and activating ligand:

  • In most tissues, GPR39 primarily couples to Gαq proteins, activating phospholipase C and triggering calcium mobilization from intracellular stores . This pathway is particularly important in pancreatic β-cells for insulin secretion regulation .

  • GPR39 also signals through G12/G13 proteins, potentially activating Rho-dependent pathways that influence cytoskeletal reorganization and cell morphology .

  • In spinal cord neurons, GPR39 exhibits a non-canonical signaling mechanism by directly complexing with glycine receptors (GlyRs) to maintain glycinergic inhibitory transmission in a G-protein-independent manner . This mechanism is crucial for pain modulation, as GPR39 knockdown in somatostatin-positive interneurons reduces glycinergic inhibition and facilitates mechanical pain transmission .

  • In vascular tissue, GPR39 activation influences NOD-like receptor protein 3 (Nlrp3) expression, affecting inflammatory processes, oxidative stress, and endothelial function . This pathway appears significant in the context of angiotensin II-induced hypertension.

These diverse signaling mechanisms highlight GPR39's versatility as a therapeutic target, with tissue-specific effects that could potentially be selectively modulated.

What are the known endogenous ligands for GPR39 and their binding properties?

Research has identified several endogenous molecules that activate GPR39:

  • Zinc ions (Zn²⁺): Initially identified as a GPR39 agonist, Zn²⁺ induces calcium responses in GPR39-expressing cells . Experimental evidence shows that 200 μM Zn²⁺ elicits a calcium response in GPR39-expressing cells but not in mock-transfected controls .

  • Bile acids: More recent research has identified bile acids, particularly 3-O-sulfated lithocholic acids, as potent GPR39 activators . Notably, 3-O-sulfated taurolithocholic acid (TLCAS) activates GPR39 in a dose-dependent manner, inducing calcium responses that last longer than those triggered by zinc .

Comparative binding studies suggest that the response to TLCAS (200 μM) persists longer than the response to equivalent concentrations of Zn²⁺, indicating potential differences in receptor-ligand kinetics or downstream signaling persistence . Evolutionary analysis suggests that GPR39 originally evolved as a bile acid receptor before acquiring zinc responsiveness in mammals, with fish orthologs responding to bile acids but not to zinc .

This dual ligand specificity of GPR39 suggests different physiological roles depending on the activating molecule and tissue context, complicating the receptor's characterization but also providing opportunities for selective therapeutic targeting.

What are the most effective methods for studying GPR39 function in vitro?

Several in vitro approaches have proven effective for investigating GPR39 function:

  • Cell-based calcium imaging: This technique measures intracellular calcium flux in response to GPR39 activation. Studies have successfully used this approach to compare responses to different ligands such as TLCAS and Zn²⁺ in GPR39-expressing cells versus controls . For reliable results, HEK293T cells can be transiently or stably transfected with GPR39 expression constructs.

  • Stable cell line generation: Creating cell lines stably expressing mouse GPR39 facilitates dose-response studies and consistent experimental conditions . When establishing these lines, it's crucial to include proper controls such as mock-transfected cells to distinguish receptor-specific from non-specific effects.

  • Receptor-ligand binding assays: These assays characterize the interaction between GPR39 and potential ligands, allowing for determination of binding affinities and kinetics.

  • siRNA knockdown in relevant cell models: Small interfering RNA (siRNA) has been successfully used to knock down GPR39 in clonal NIT-1 β-cells, revealing its cell-autonomous regulation of insulin receptor substrate-2 and pancreatic and duodenal homeobox-1 expression . This approach can uncover receptor-dependent changes in downstream gene expression.

  • Structure-based high-throughput virtual screening (HTVS): This computational approach has been used to identify potential small molecule ligands for GPR39, such as Z1780628919, which was subsequently validated for antihypertensive function .

For optimal results, combining multiple techniques is recommended to provide complementary insights into GPR39 function and signaling mechanisms.

How can recombinant GPR39 protein fragments be utilized in blocking experiments?

Recombinant GPR39 protein fragments serve as valuable tools for validation and specificity control in experimental settings. The following methodology has been established for their use in blocking experiments:

  • For immunohistochemistry/immunocytochemistry (IHC/ICC) and Western blot (WB) experiments, a 100x molar excess of the protein fragment control should be used, based on the antibody concentration and molecular weight .

  • The antibody-protein control fragment mixture should be pre-incubated for 30 minutes at room temperature before application to the experimental sample .

  • Human GPR39 control fragments (such as aa 367-443) can be used in cross-species experiments but researchers should account for the limited sequence identity (approximately 55%) with mouse and rat orthologs .

  • When designing blocking experiments, consideration should be given to the specific epitope recognized by the antibody and whether the recombinant fragment encompasses this region.

  • Appropriate negative controls should include irrelevant protein fragments of similar size to ensure specificity of the blocking effect.

This methodological approach helps confirm antibody specificity and validate experimental findings, particularly in studies examining GPR39 expression patterns or protein interactions.

What are the key considerations when designing GPR39 knockout experiments?

Designing effective GPR39 knockout (KO) studies requires careful consideration of several factors:

  • Knockout strategy: Multiple approaches have been used to generate GPR39 KO models, including CRISPR/Cas9 methods. For example, one study utilized CRISPR/Cas9 to create a 44-bp deletion causing a p.Lys38fs*57X frameshift mutation in a mixed genetic background (C57BL/6/Tar × CBA/Tar) .

  • Genetic background considerations: The background strain can significantly influence phenotypic outcomes. GPR39 knockout studies have been conducted in C57BL/6J mice and mixed background strains . Consistency in genetic background is essential for reproducible results.

  • Age-dependent phenotypes: GPR39 function may become more critical under conditions of increased physiological demand. Studies have shown that young GPR39⁻/⁻ mice have normal body weight, food intake, and fasting glucose/insulin levels, but older mice (52 weeks) show trends toward decreased insulin levels after glucose challenge . Therefore, experimental timeframes should account for potential age-dependent manifestations.

  • Diet challenge paradigms: Diet-induced stress can reveal phenotypes not apparent under standard conditions. GPR39⁻/⁻ mice fed either low-fat/high-sucrose or high-fat/high-sucrose diets developed increased fed glucose levels and decreased serum insulin during glucose tolerance tests, despite unchanged insulin tolerance .

  • Tissue-specific knockdown: For examining tissue-specific functions, targeted approaches such as siRNA-mediated knockdown in specific cell populations (e.g., SOM⁺ interneurons) can reveal cell-autonomous effects of GPR39 .

  • Validation of knockout efficiency: Both mRNA and protein levels should be assessed to confirm complete ablation of GPR39 expression in the relevant tissues.

These considerations ensure that GPR39 knockout experiments are appropriately designed to reveal the receptor's physiological functions in specific contexts.

How does GPR39 contribute to hypertension pathophysiology and potential therapeutic interventions?

GPR39 plays a significant role in the pathophysiology of angiotensin II (Ang II)-induced hypertension through several mechanisms:

  • Upregulated expression: GPR39 expression is increased in the aorta of both hypertensive patients and mouse models of hypertension, suggesting its involvement in vascular dysfunction .

  • Vascular fibrosis: GPR39 knockout mice show mitigated vascular fibrosis when challenged with Ang II, indicating that GPR39 contributes to the structural changes in blood vessels associated with hypertension .

  • Endothelial function: Ablation of GPR39 augments endothelium-dependent vasodilation and inhibits endothelial inflammation, oxidative stress, and apoptosis in Ang II-challenged mice .

  • Nlrp3 inflammasome regulation: GPR39 knockout decreases NOD-like receptor protein 3 (Nlrp3) gene expression in Ang II-stimulated endothelial cells. Importantly, Nlrp3 activation counteracts the beneficial effects of GPR39 knockout, suggesting that GPR39 exerts its hypertensive effects at least partly through Nlrp3-dependent mechanisms .

Therapeutic implications from this research include:

  • Small molecule ligand development: Structure-based high-throughput virtual screening has identified Z1780628919 as a small molecule ligand of GPR39 that reduces Ang II-induced hypertension and improves vascular function in vivo .

  • Nlrp3 pathway targeting: The GPR39-Nlrp3 axis represents a potential intervention point, as downregulation of Nlrp3 appears to mediate the beneficial effects of GPR39 inhibition on vascular function .

  • Combination therapies: Given the multiple pathways affected by GPR39 in hypertension, combination approaches targeting both GPR39 and its downstream effectors might provide enhanced therapeutic benefits.

These findings suggest that GPR39 antagonism or modulation represents a promising strategy for hypertension management, particularly in cases where angiotensin II plays a significant pathophysiological role.

What is the relationship between GPR39 and insulin secretion in metabolic disorders?

GPR39 plays a crucial role in insulin secretion that becomes particularly important under conditions of increased metabolic demand:

  • Age-dependent effects: While young GPR39⁻/⁻ mice show normal fasting glucose and insulin levels, 52-week-old knockout mice display a trend toward decreased insulin levels after oral glucose challenge, suggesting an age-dependent requirement for GPR39 in maintaining adequate insulin secretion .

  • Diet-induced metabolic stress: When challenged with either low-fat/high-sucrose or high-fat/high-sucrose diets, GPR39⁻/⁻ mice develop increased fed glucose levels and decreased serum insulin during oral glucose tolerance tests, despite unchanged insulin tolerance . This indicates that GPR39 is required for appropriate insulin secretion under metabolic stress conditions.

  • Molecular mechanisms: GPR39 regulates the expression of crucial β-cell factors:

    • Insulin receptor substrate-2 (IRS-2): siRNA-mediated knockdown of GPR39 in NIT-1 β-cells reduces IRS-2 expression in a cell-autonomous manner, and IRS-2 mRNA is significantly decreased in the pancreas of GPR39⁻/⁻ mice .

    • Pancreatic and duodenal homeobox-1 (PDX-1): GPR39 knockdown also affects PDX-1 expression, a critical transcription factor for β-cell function and insulin gene transcription .

  • Islet functionality: Interestingly, isolated islets from GPR39⁻/⁻ mice show comparable glucose-stimulated insulin secretion ex vivo compared to wild-type controls, suggesting that GPR39 is not required for pancreas development or basic ex vivo insulin secretion . This points to a more complex in vivo regulatory role.

This research suggests that GPR39 agonists may have therapeutic potential for type 2 diabetes, particularly in addressing the relative insulin deficiency that develops with age or in response to diet-induced insulin resistance. The receptor appears to serve as an adaptive mechanism that facilitates enhanced insulin secretion under conditions of increased metabolic demand.

How does GPR39 influence pain processing and what are the implications for analgesic development?

GPR39 has emerged as a significant modulator of pain processing, particularly mechanical hyperalgesia, through its actions in the spinal cord:

  • Expression in pain circuits: GPR39 is expressed in somatostatin-positive (SOM⁺) interneurons, a mechanosensitive subpopulation critical for the conveyance of mechanical pain signals in the spinal cord .

  • Non-canonical signaling mechanism: Unlike its typical G-protein coupled signaling, GPR39 in the spinal cord complexes specifically with inhibitory glycine receptors (GlyRs) and helps maintain glycinergic transmission in a manner independent of G protein signaling . This represents a novel mode of action for GPR39.

  • Effect on pain transmission: Targeted knockdown of GPR39 in SOM⁺ interneurons reduces glycinergic inhibition and facilitates excitatory output from these interneurons to spinoparabrachial neurons . This engagement of superspinal neural circuits affects both the sensory discriminative and affective motivational domains of pain experience.

  • Therapeutic potential: Pharmacological activation of GPR39 or augmenting GPR39 interaction with GlyRs at the spinal level effectively alleviates both sensory and affective pain induced by complete Freund's adjuvant in experimental models . This suggests GPR39 as a promising therapeutic target for inflammatory mechanical pain.

These findings have significant implications for analgesic development:

  • Novel pain target: GPR39 represents a previously unrecognized target for pain management that affects both sensory and affective aspects of pain.

  • Targeted approach: The specific interaction between GPR39 and glycine receptors offers the potential for highly selective interventions that might avoid the side effects associated with broadly acting analgesics.

  • Inflammatory pain focus: The particularly strong effects observed in inflammatory pain models suggest GPR39-based therapies might be especially valuable for conditions like arthritis or inflammatory bowel disease.

  • Dual pathway modulation: By affecting both sensory discrimination and affective components of pain, GPR39-targeted therapies might address the multidimensional nature of chronic pain more effectively than treatments targeting only sensory pathways.

What are the key considerations when analyzing GPR39 knockout mouse phenotypes?

When analyzing phenotypes from GPR39 knockout models, researchers should consider several critical factors to ensure accurate interpretation:

  • Context-dependent effects: GPR39 deficiency may not manifest obvious phenotypes under basal conditions but becomes apparent under physiological stress:

    • Young GPR39⁻/⁻ mice show normal metabolic parameters, while older mice (52 weeks) begin to display metabolic abnormalities .

    • Diet challenges with high-sucrose or high-fat diets reveal insulin secretion defects not apparent under standard diet conditions .

    • Hypertensive challenges with angiotensin II are required to reveal the vascular protective effects of GPR39 deletion .

  • Compensatory mechanisms: Developmental compensation can mask phenotypes in constitutive knockout models. Consider using:

    • Inducible knockout systems to avoid developmental adaptation

    • Pharmacological inhibition as a complementary approach

    • Tissue-specific knockdown to isolate cell-autonomous effects

  • Background strain effects: Different mouse strains may show varying phenotypic manifestations of GPR39 deficiency. Studies have used:

    • C57BL/6J background

    • Mixed genetic backgrounds (C57BL/6/Tar × CBA/Tar)

  • Sex differences: Male mice have commonly been used in GPR39 studies , but potential sex differences should be considered, especially for metabolic and cardiovascular phenotypes.

  • Ex vivo versus in vivo discrepancies: GPR39⁻/⁻ mice show normal glucose-stimulated insulin secretion in isolated islets but impaired insulin secretion in vivo , highlighting the importance of evaluating phenotypes at multiple levels.

  • Interaction with environmental factors: Consider how environmental conditions (stress, housing, microbiome) might influence the manifestation of GPR39-related phenotypes.

How should researchers approach contradictory findings in GPR39 literature?

The GPR39 research field contains some seemingly contradictory findings that require careful interpretation:

  • Ligand identification discrepancies:

    • Initially classified as an orphan receptor

    • Later identified as a zinc receptor

    • More recently recognized as responding to bile acids, particularly 3-O-sulfated lithocholic acids

    Resolution approach: Consider GPR39 as a receptor with multiple endogenous ligands whose relative importance may vary by tissue context and species. Validate ligand responses in your specific experimental system.

  • Signaling mechanism variations:

    • Canonical G-protein coupled signaling through Gαq and G12/G13 in most tissues

    • Non-canonical direct interaction with glycine receptors independent of G-protein signaling in spinal neurons

    Resolution approach: Recognize that GPCRs can signal through both G-protein-dependent and independent mechanisms. Investigate both pathways in your experimental system rather than assuming a single signaling mode.

  • Physiological role contradictions:

    • No apparent phenotype in young GPR39⁻/⁻ mice vs. significant metabolic phenotypes in aged or diet-challenged knockout mice

    • Normal ex vivo insulin secretion in isolated islets vs. impaired in vivo insulin secretion

    Resolution approach: Design experiments that account for age, diet, and physiological context. Consider that GPR39 may serve as a stress-responsive system rather than being required for basal function.

  • Therapeutic strategy disagreements:

    • GPR39 activation beneficial for pain management

    • GPR39 inhibition beneficial for hypertension management

    Resolution approach: Recognize that the optimal therapeutic strategy may be tissue-specific. Consider developing tissue-targeted approaches rather than systemic modulation.

When encountering contradictory findings, researchers should:

  • Carefully examine methodological differences that might explain discrepancies

  • Consider biological context (tissue, species, age, disease state)

  • Design experiments that directly address the contradiction

  • Report all findings transparently, including both confirmatory and contradictory results

What are the emerging trends in GPR39 research and potential future directions?

Analysis of recent GPR39 research reveals several emerging trends and promising directions for future investigation:

  • Novel ligand discovery:

    • The identification of bile acids as GPR39 ligands opens new avenues for understanding its physiological roles

    • Structure-based drug discovery approaches have identified novel small molecule ligands like Z1780628919

    • Future research should continue exploring the ligand binding profiles and structure-activity relationships

  • Evolutionary perspectives:

    • The finding that GPR39 evolved first as a bile acid receptor before gaining zinc responsiveness in mammals provides evolutionary context

    • Comparative studies across species could further illuminate the receptor's evolving functions

  • Non-canonical signaling mechanisms:

    • The discovery of G-protein-independent signaling through direct interaction with glycine receptors represents a paradigm shift in understanding GPR39 function

    • Future research should explore whether similar non-canonical mechanisms exist in other tissues

  • Therapeutic targeting approaches:

    • Disease-specific interventions targeting GPR39 are emerging for:

      • Hypertension (GPR39 antagonism or modulation)

      • Type 2 diabetes (GPR39 agonism)

      • Inflammatory pain (GPR39 activation or enhanced GlyR interaction)

    • Future development of tissue-specific or pathway-selective modulators could optimize therapeutic outcomes

  • Intersection with inflammatory pathways:

    • The connection between GPR39 and Nlrp3 inflammasome regulation suggests broader implications in inflammatory disorders

    • Future research should explore GPR39's role in other inflammatory conditions

  • Advanced genetic approaches:

    • Cell-type specific and inducible knockout models will help overcome limitations of constitutive knockouts

    • CRISPR-based approaches for precise genomic editing are being applied to GPR39 research

  • Translational medicine opportunities:

    • The identification of human aortic GPR39 upregulation in hypertension patients suggests direct clinical relevance

    • Development of GPR39-targeted diagnostics and therapeutics represents a promising translational direction

These trends suggest that GPR39 research is moving beyond basic characterization toward mechanistic understanding and therapeutic application, with particular promise in metabolic, cardiovascular, and pain-related conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.