Recombinant Mouse G-protein coupled receptor 56 (Gpr56)

Shipped with Ice Packs
In Stock

Description

Expression Pattern of GPR56 in Mouse Tissues

GPR56 exhibits a distinct expression pattern across various mouse tissues, reflecting its diverse physiological roles. In mice, GPR56 is predominantly expressed in developing neural cells, hematopoietic precursors, and muscle tissues . Within the central nervous system (CNS), GPR56 shows dynamic expression during development, with particularly high levels in oligodendrocyte precursor cells (OPCs) that decline as these cells mature into myelinating oligodendrocytes .

In the hematopoietic system, GPR56 serves as a transcriptional target of the heptad complex of hematopoietic transcription factors during the endothelial to hematopoietic stem cell transition . Quantitative PCR analysis has been used to measure Gpr56 expression levels in various cell populations using specific Taqman gene expression primer sets (Mm00817704_m1) with β-actin (Mm00607939_s1) as a reference gene . This precise quantification has revealed tissue-specific and developmental-stage-dependent regulation of GPR56 expression.

Techniques for Detecting GPR56 Expression

Several methods have been employed to detect GPR56 expression in mouse tissues, including:

  1. RT-PCR using specific primers such as JP593F (5′-ATCAGCCAGCAGTTACAG-3′) and JP593R (5′-GAAGCAACAGCGAGTATG-3′)

  2. Western blot analysis using GPR56-specific antibodies

  3. Flow cytometry for cell surface expression detection

  4. Immunohistochemistry for tissue localization studies

These techniques have been instrumental in characterizing the expression patterns of GPR56 across different tissues and developmental stages, providing insights into its potential functions.

Signaling Mechanisms of GPR56

GPR56 activates multiple signaling pathways depending on its cellular context and binding partners. Upon ligand binding, GPR56 couples primarily to Gα12/13 proteins to activate the RhoA signaling pathway, which is crucial for cell migration, adhesion, and proliferation . Additionally, GPR56 can couple to Gαq/11 proteins when associated with tetraspanins CD9 and CD81, leading to the activation of different downstream effectors .

The signaling mechanisms of GPR56 include:

  1. Activation of RhoA and mammalian target of rapamycin (mTOR) pathway upon ligand binding

  2. Suppression of PKCα activation, which regulates angiogenesis

  3. Activation of NF-kB, PAI-1, and TCF transcriptional response elements upon forced expression

Interestingly, the N-terminal fragment (NTF) of GPR56 plays a critical regulatory role in signaling. Lack of the NTF causes stronger RhoA signaling and β-arrestin accumulation, leading to extensive ubiquitination of the C-terminal fragment (CTF) . This indicates that the NTF may function as a modulator of GPR56 signaling intensity.

Role in Neural Development

GPR56 plays a crucial role in neural development, particularly in cortical formation and patterning. The interaction between GPR56 and collagen III inhibits neural migration, which is essential for proper lamination of the cerebral cortex . Studies using Gpr56-knockout mice have revealed that loss of GPR56 leads to neuronal malformation in the cerebral cortex, characterized by defective pial basement membrane, abnormal localized radial glial endfeet, malpositioned Cajal-Retzius cells, and overmigrated neurons .

The significance of GPR56 in neural development is underscored by the fact that loss-of-function mutations in GPR56 cause bilateral frontoparietal polymicrogyria (BFPP), a severe cortical malformation characterized by disordered cortical lamination in the frontal cortex . These findings highlight the critical role of GPR56 in regulating neural migration and cortical development.

Role in Oligodendrocyte Development and Myelination

One of the most significant functions of GPR56 is its role in oligodendrocyte development and CNS myelination. Gpr56-knockout mice exhibit hypomyelination of the central nervous system, manifesting as decreased staining for compact myelin in the corpus callosum . This hypomyelination results from decreased oligodendrocyte precursor cell (OPC) proliferation and diminished levels of active RhoA, leading to fewer mature oligodendrocytes and a reduced number of myelinated axons in the corpus callosum and optic nerves .

The cell-autonomous nature of GPR56's role in oligodendrocyte development has been demonstrated through conditional ablation studies. Conditional knockout of Gpr56 specifically in OPCs leads to a reduced number of mature oligodendrocytes, similar to what is observed in constitutive Gpr56-knockout mice . This confirms that GPR56 functions directly within the oligodendrocyte lineage to regulate their development and myelination capacity.

Generation and Validation of Gpr56-Deficient Mice

Gpr56-deficient mice (B6N.129S5-Gpr56tm1Lex/Mmcd) were generated by Genentech and have been extensively used to study the functions of GPR56 . These mice were created through genomic modification of the Gpr56 alleles, which can be verified by genotyping PCR using specific primers:

  • DNA085-5 (5′-CGAGAAGACTTCCGCTTCTG-3′)

  • DNA085-14 (5′-AAAGTAGCTAAGATGCTCTCC-3′)

  • Neo3a (5′-GCAGCGCATCGCCTTCTATC-3′)

These primers allow identification of wild-type (639bp) and Gpr56-deficient (369bp) alleles . While previous studies reported an absence of functional GPR56 protein in homozygous Gpr56-deficient mice, more recent analyses using western blot and flow cytometry have suggested residual protein expression in multiple cellular compartments, including the brain, liver, and hematopoietic system .

Hematological Parameters in Gpr56-Deficient Mice

Peripheral blood analysis of Gpr56-deficient mice has revealed no statistically significant differences compared to wild-type mice across various hematological parameters. The table below summarizes these findings:

ParameterGpr56 +/+Gpr56 defp-value
WBCs (K/μL)9.29±5.126.87±3.780.20
Neutrophils (K/μL)2.71±1.911.56±0.750.10
Lymphocytes (K/μL)5.74±4.095.03±3.040.64
Monocytes (K/μL)0.51±0.30.24±0.290.13
Eosinophils (K/μL)0.26±0.190.03±0.030.06
Basophils (K/μL)0.04±0.070.01±0.010.12
RBC (M/μL)9.42±1.259.03±2.210.58
Hb (g/dL)12.84±1.8912.33±3.210.64
HCT (%)46.65±6.2145.57±12.050.78
MCV (fL)49.46±2.8950.13±2.580.58
PLT (K/μL)766.58±200.12829.42±206.480.43

Values shown are means ± SEM (n=12 mice per group). WBC indicates white blood cell; RBC, red blood cell; Hb, hemoglobin; HCT, hematocrit; MCV, mean corpuscular volume; PLT, platelets .

Despite the absence of significant differences in peripheral blood parameters, Gpr56-deficient mice exhibit other phenotypic abnormalities, particularly in the CNS and male reproductive system. These include hypomyelination of the central nervous system and reduced fertility in male mice due to defects in seminiferous tubule development .

Clinical Significance of GPR56

GPR56 has significant clinical relevance, particularly in neurodevelopmental disorders and cancer. GPR56 was the first adhesion GPCR causally linked to a disease, with loss-of-function mutations causing bilateral frontoparietal polymicrogyria (BFPP) . Brain MRI of BFPP patients reveals bilateral foci of T2 signal intensity change within the cerebral white matter, indicative of myelination defects . These findings highlight the critical role of GPR56 in brain development and myelination.

In addition to its role in neurodevelopment, GPR56 has been implicated in various types of cancer. GPR56 is expressed in glioblastoma/astrocytoma as well as in esophageal squamous cell, breast, colon, non-small cell lung, ovarian, and pancreatic carcinoma . Studies have shown that GPR56 can have both tumor-promoting and tumor-suppressive effects depending on the cancer type:

  1. GPR56 inhibits melanoma tumor growth and metastasis

  2. Silenced expression of GPR56 in HeLa cells enhances apoptosis and anoikis but suppresses anchorage-independent growth and cell adhesion

  3. In acute myeloid leukemia, silencing GPR56 decreases adhesion and cell growth while inducing apoptosis through reduced RhoA signaling

  4. GPR56 suppresses angiogenesis and melanoma growth by inhibiting vascular endothelial growth factor (VEGF) via PKCα signaling pathway

These diverse effects highlight the context-dependent functions of GPR56 and suggest its potential as a therapeutic target in various diseases.

Applications of Recombinant Mouse GPR56

Recombinant Mouse GPR56 has numerous applications in biomedical research:

  1. It serves as a valuable tool for studying the binding interactions with its ligands, including transglutaminase 2 and collagen III

  2. It facilitates the investigation of GPR56 signaling pathways and their roles in various cellular processes

  3. It enables the development of targeted therapeutics for diseases associated with GPR56 dysfunction

  4. The recombinant N-terminal fragment of GPR56 has been shown to interact with glioma cells to inhibit cellular adhesion, suggesting potential therapeutic applications in glioblastoma

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Adgrg1; Cyt28; Gpr56; Adhesion G-protein coupled receptor G1; G-protein coupled receptor 56; Serpentine receptor cyt28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-687
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
GSPREDFRFCGQRNQTQQSTLHYDQSSEPHIFVWNTEETLTIRAPFLAAPDIPRFFPEPR GLYHFCLYWSRHTGRLHLRYGKHDYLLSSQASRLLCFQKQEQSLKQGAPLIATSVSSWQI PQNTSLPGAPSFIFSFHNAPHKVSHNASVDMCDLKKELQQLSRYLQHPQKAAKRPTAAFI SQQLQSLESKLTSVSFLGDTLSFEEDRVNATVWKLPPTAGLEDLHIHSQKEEEQSEVQAY SLLLPRAVFQQTRGRRRDDAKRLLVVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVTNL SDPVVLTFQHQPQPKNVTLQCVFWVEDPASSSTGSWSSAGCETVSRDTQTSCLCNHLTYF AVLMVSSTEVEATHKHYLTLLSYVGCVISALACVFTIAAYLCSRRKSRDYTIKVHMNLLS AVFLLDVSFLLSEPVALTGSEAACRTSAMFLHFSLLACLSWMGLEGYNLYRLVVEVFGTY VPGYLLKLSIVGWGFPVFLVTLVALVDVNNYGPIILAVRRTPERVTYPSMCWIRDSLVSY VTNLGLFSLVFLFNLAMLATMVVQILRLRPHSQNWPHVLTLLGLSLVLGLPWALVFFSFA SGTFQLVILYLFSIITSFQGFLIFLWYWSMRFQAQGGPSPLKNNSDSAKLPISSGSTSSS RI
Uniprot No.

Target Background

Function
GPR56 is a receptor involved in cell adhesion and potentially cell-cell interactions. It mediates cell-matrix adhesion in developing neurons and hematopoietic stem cells. GPR56 functions as a receptor for collagen III/COL3A1 in the developing brain, playing a role in regulating cortical development, specifically in maintaining pial basement membrane integrity and cortical lamination. Binding to the COL3A1 ligand inhibits neuronal migration and activates the RhoA pathway by coupling to GNA13 and potentially GNA12. GPR56 is involved in the maintenance of hematopoietic stem cells and/or leukemia stem cells in the bone marrow niche. It plays a critical role in tumorigenesis and is essential for testis development.
Gene References Into Functions
  1. All hematopoietic stem cells (HSCs) in mouse bone marrow mononuclear cells express GPR56 protein on their surface, indicating that GPR56 is a positive marker for HSCs. PMID: 29225194
  2. Collagen III protects beta-cells from cytokine-induced apoptosis, triggers increases in [Ca(2+)]i, and potentiates glucose-induced insulin secretion from WT islets but not from Gpr56(-/-) islets. Deletion of GPR56 does not affect glucose-induced insulin secretion in vitro and does not impair glucose tolerance in adult mice. PMID: 29855662
  3. Deletion of G-protein coupled receptor 56 (GPR56) in the mouse germline abrogates progastrin-dependent colonic mucosal proliferation and increases apoptosis. PMID: 28380450
  4. This research determines the crystal structure of the GPR56 extracellular domain. PMID: 27657451
  5. Knockdown of Gpr56 delays the onset of HOXA9/MEIS1-induced AML. PMID: 27063597
  6. GPR56 is a cell-autonomous regulator of oligodendrocyte development. PMID: 25607655
  7. Although GPR56 is abundantly and selectively expressed by primitive HSPCs, its high level expression is largely dispensable for steady-state and regenerative hematopoiesis. PMID: 25840412
  8. This study knocked down GPR56 in cardiomyocytes and found that GPR56 promoted Ang II-induced cardiomyocyte hypertrophy and contributed to PCBP2 effects on cardiomyocyte hypertrophy. PMID: 26116532
  9. Data indicates that Gpr56, a G-coupled protein receptor, is required for hematopoietic cluster formation during the transdifferentiation process in endothelial to hematopoietic cell transition (EHT). PMID: 25547674
  10. These data illustrate a signaling pathway through GPR56 that regulates muscle hypertrophy associated with resistance/loading-type exercise. PMID: 25336758
  11. This research focuses on adhesion G protein-coupled receptor GPR56-mediated RhoA activation induced by collagen III stimulation. PMID: 24949629
  12. The study explores the role of TG2 in GPR56-mediated melanoma inhibition. The uncovered antagonistic relationship between GPR56 and TG2 proposes a mechanism by which extracellular matrix accumulation/crosslinking in tumors may be reversed. PMID: 24356421
  13. GPR56 functions alongside alpha3beta1 integrin in regulating cerebral cortical development. PMID: 23874761
  14. This research reveals that GPR56 is expressed in multiple cell types in the preplate, marginal zone, subventricular zone, and ventricular zone in the developing cerebral cortex. PMID: 22351047
  15. GPR56 mutations cause bilateral frontoparietal polymicrogyria through various mechanisms. PMID: 21349848
  16. Data suggests that GPR56 might act to establish a spatial and/or temporal cue for asymmetric cord remodeling during male gonad development. PMID: 20981830
  17. GPR56 exhibits preferential expression in neuronal progenitor cells of the cerebral cortical ventricular and subventricular zones during periods of neurogenesis. PMID: 15044805
  18. This research investigates the potential pleiotrophic role of secretin during embryonic development. PMID: 16888225
  19. These findings suggest that the secretin receptor system plays a significant role in the central nervous system related to social behavior. PMID: 17008357
  20. Mutations in the SCTR gene could lead to mild polydipsia and polyuria. PMID: 17283064
  21. Mutations in GPR56 impair trafficking of the mutant protein to the plasma membrane, providing insights into how BFPP-associated mutations affect GPR56 function. PMID: 17576745
  22. These results define the biochemical properties of GPR56 protein and suggest that the expression of GPR56 protein is suppressed in human pancreatic cancer cells. PMID: 17932623
  23. Results indicate that GPR56 participates in the regulation of neural progenitor cells movement through the Galpha(12/13) and Rho signaling pathway, suggesting its important role in the development of the central nervous system. PMID: 18378689
  24. GPR56 regulates pial basement membrane integrity and cortical lamination. PMID: 18509043
  25. These studies establish a novel role for GPR56 in the adhesion of developing neurons to basal lamina molecules and suggest that this adhesion is critical for maintaining the pia and proper cerebellar morphogenesis. PMID: 19515912

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 2 family, LN-TM7 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.; [ADGRG1 N-terminal fragment]: Secreted.; [ADGRG1 C-terminal fragment]: Membrane raft.
Tissue Specificity
Expressed in neural progenitor cells in fetal forbrain. Expressed in migrating neurons. Expressed in radial glial endfeet (at protein level). Expressed in peritubular myoid cells, Sertoli cells, and germ cells of the testis.

Q&A

What is the molecular structure of mouse Gpr56 and how does it compare to human GPR56?

Mouse Gpr56, like its human ortholog, belongs to the adhesion G-protein coupled receptor (AGPCR) family. The protein contains an extracellular region with a mucin-like domain followed by a GPCR-autoproteolysis inducing (GAIN) domain, seven transmembrane regions, and a cytoplasmic tail. A distinguishing feature of Gpr56 is its constitutive self-cleavage at the proteolytic site within the GAIN domain, which generates a membrane-spanning C-terminal fragment (CTF) and an extracellular N-terminal fragment (NTF) that remain noncovalently associated at the cell surface . This self-cleavage process is crucial for receptor function and signaling. While mouse and human GPR56 share significant structural homology, researchers should note potential species-specific differences in expression patterns and some functional properties when translating findings between models.

What are the primary signaling pathways associated with Gpr56 activation?

Gpr56 primarily couples to G12/13 family G-proteins to initiate downstream signaling cascades. Upon activation, the CTF of Gpr56 recruits Gα proteins, leading to activation of multiple pathways including RhoA and mechanistic target of rapamycin (mTOR) . In skeletal muscle, Gpr56 signaling through Gα12/13 promotes insulin-like growth factor 1 (IGF-1) expression, which is essential for muscle hypertrophy . In neuronal contexts, these pathways regulate neural progenitor proliferation and migration. Additionally, in models of depression, Gpr56 activation has been shown to upregulate AKT/GSK3/EIF4 pathways, which are implicated in antidepressant responses . The G12/13-RhoA axis particularly influences cytoskeletal dynamics, affecting cell adhesion, morphology, and migration across various cell types.

How is Gpr56 expression regulated across different tissues and physiological states?

Gpr56 exhibits a complex tissue-specific expression pattern that changes in response to various physiological conditions. The receptor is widely expressed, with particularly high levels in the brain, heart, and thyroid gland . In the immune system, Gpr56 is variably expressed on platelets, cytotoxic NK cells, and various T lymphocyte populations . Expression regulation has been demonstrated in several contexts:

  • In skeletal muscle, Gpr56 expression increases during mechanical overload and is regulated by the transcriptional coactivator PGC-1α4 .

  • In depression models, chronic stress downregulates Gpr56 in both blood and the prefrontal cortex (PFC), which can be reversed by effective antidepressant treatment .

  • In cancer tissues, GPR56 expression is often elevated compared to normal counterparts, suggesting dysregulation in malignant states .

These expression patterns provide important insights for researchers designing tissue-specific interventions targeting Gpr56.

What are the most effective approaches for measuring Gpr56 activation in experimental settings?

Measuring Gpr56 activation requires specialized approaches due to its unique activation mechanism. The most reliable methods include:

  • Reporter gene assays: The serum response element luciferase (SRE-Luc) reporter system has proven particularly effective for monitoring G12/13-coupled signaling downstream of Gpr56 . This approach detects activation of serum response factor (SRF) transcription factor, which occurs following RhoA activation.

  • G-protein coupling assays: Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) techniques can directly measure the interaction between Gpr56 and G12/13 proteins.

  • Downstream signaling readouts: Measuring phosphorylation states of key proteins in Gpr56 signaling cascades, such as RhoA activity, ROCK phosphorylation, or AKT/GSK3 pathway activation .

  • Engineered receptor systems: Researchers have successfully employed modified receptors for functional studies, including truncated tethered-peptide-agonist constructs (GPR56 A386M) for antagonist screening and fully-active receptors with intact tethered-peptide-agonists (GPR56 7TM) for agonist screening .

When selecting an activation measurement method, researchers should consider the specific signaling pathway of interest and include appropriate positive and negative controls.

What genetic tools are most useful for manipulating Gpr56 expression in mouse models?

Several genetic approaches have proven valuable for manipulating Gpr56 expression in mice:

  • Viral vector-mediated knockdown: Stereotaxic injection of viral vectors carrying Gpr56-targeting shRNA enables region-specific silencing, particularly valuable for brain studies. This approach has successfully demonstrated that Gpr56 knockdown in the prefrontal cortex induces depressive-like behaviors and executive dysfunction .

  • Conditional knockout strategies: Cre-loxP systems allow for tissue-specific and temporally controlled deletion of Gpr56, helping distinguish developmental versus adult functions.

  • Overexpression models: Viral delivery of Gpr56 cDNA has demonstrated that PFC Gpr56 overexpression in naïve mice decreases immobility in behavioral tests, indicating antidepressant-like effects .

  • Global knockout models: Complete Gpr56 knockout mice have been instrumental in studying its role in muscle hypertrophy, where genetic ablation attenuates overload-induced muscle growth .

Each approach offers distinct advantages, and researchers should select the method that best aligns with their specific experimental questions while considering potential compensatory mechanisms and developmental effects.

What are the current challenges in developing specific agonists and antagonists for Gpr56?

Developing selective modulators for Gpr56 faces several significant challenges that researchers must address:

  • Complex activation mechanism: The unique tethered-peptide-agonist activation mode of adhesion GPCRs complicates traditional drug screening approaches .

  • Structural knowledge gaps: Limited information about the complete three-dimensional structure of Gpr56, particularly in its activated state, hampers structure-based drug design efforts.

  • Assay development hurdles: Establishing reliable high-throughput screening systems that accurately reflect receptor activation has proven difficult.

  • Selectivity issues: Ensuring specificity against the 32 other members of the adhesion GPCR family requires extensive counterscreening.

Despite these challenges, progress has been made using specialized screening platforms. High-throughput assays employing engineered receptors with SRE-Luc reporters have identified a partial agonist, 3-a-acetoxydihydrodeoxygedunin (3aDOG), and an antagonist, dihydromunduletone (DHM) . Validating hits requires comprehensive counterscreening, such as testing compounds against constitutively active Gα13-Q226L to confirm specificity to the receptor rather than downstream effectors.

How does Gpr56 contribute to skeletal muscle hypertrophy in response to mechanical loading?

Gpr56 plays a critical role in skeletal muscle adaptation to mechanical loading through several coordinated mechanisms:

  • Transcriptional regulation: Mechanical tension upregulates Gpr56 expression via the transcriptional coactivator PGC-1α4, which is induced during resistance-type exercise .

  • Ligand interaction: Increased expression of both Gpr56 and its ligand collagen type III occurs during mechanical overload, facilitating receptor activation .

  • G-protein signaling: Upon activation, Gpr56 signals through Gα12/13 proteins to initiate anabolic pathways .

  • IGF-1 induction: A key downstream effect of Gpr56 activation in muscle is increased expression of insulin-like growth factor 1 (IGF-1), a critical mediator of muscle growth .

The functional significance of this pathway is demonstrated by studies showing that genetic ablation of Gpr56 expression attenuates overload-induced muscle hypertrophy and associated anabolic signaling . Additionally, forced expression of Gpr56 results in myotube hypertrophy through IGF-1 expression, dependent on Gα12/13 signaling . These findings position Gpr56 as a potential therapeutic target for conditions involving muscle wasting or for enhancing training adaptations.

What evidence supports Gpr56 as a biomarker for antidepressant response?

Compelling evidence from both human and animal studies positions Gpr56 as a promising biomarker for antidepressant response:

  • Human clinical studies: Responders to serotonin-norepinephrine reuptake inhibitor (SNRI) treatment display increased GPR56 mRNA in blood, while non-responders show no such change . This pattern has been replicated across multiple cohorts, suggesting reliability.

  • Post-mortem findings: GPR56 is downregulated in the prefrontal cortex of individuals with depression who died by suicide, indicating central nervous system relevance .

  • Animal model validation: In mice subjected to unpredictable chronic mild stress (UCMS), a validated depression model, Gpr56 expression decreases in both blood and prefrontal cortex . Crucially, effective antidepressant treatment normalizes Gpr56 levels specifically in mice showing behavioral improvement (responders), but not in non-responder mice .

  • Blood-brain correlation: Under stress conditions, blood and prefrontal cortex Gpr56 mRNA levels show significant correlation (r = 0.51; p = 0.02), suggesting that peripheral measurements may reflect central changes .

  • Mechanistic relevance: Gpr56 knockdown in mouse prefrontal cortex reduces responsiveness to antidepressant treatment in behavioral tests, demonstrating causality rather than mere correlation .

The consistency of these findings across species and their mechanistic underpinning suggest that Gpr56 expression changes could serve as a clinically useful biomarker for guiding personalized depression treatment approaches.

What is the evidence supporting Gpr56 as a potential oncogenic factor and cancer therapeutic target?

Multiple lines of evidence indicate Gpr56 may function as an oncogenic factor and represent a promising cancer treatment target:

  • Expression patterns: Higher GPR56 expression correlates with cellular transformation in several cancer tissues compared to normal counterparts .

  • Functional studies: RNA interference-mediated GPR56 silencing induces apoptosis and reduces anchorage-independent growth of cancer cells by increasing anoikis (detachment-induced cell death) . Conversely, cDNA overexpression increases foci formation in mouse fibroblast NIH3T3 cells .

  • In vivo validation: When GPR56 silencing was induced in xenograft tumor models, significant tumor responses including regression were observed, providing proof-of-concept for therapeutic potential .

  • Molecular mechanisms: Expression profiling of GPR56-silenced cancer cells revealed altered expression of genes involved in integrin-mediated signaling and cell adhesion pathways . This was functionally confirmed by observations that GPR56 silencing reduced cancer cell adhesion to extracellular matrix .

  • Therapeutic window: Despite its oncogenic potential, GPR56-null mutations appear to cause limited phenotypes outside the central nervous system in adults, suggesting a potentially favorable safety profile for GPR56-targeting therapies .

The targetable nature of G protein-coupled receptors by small molecules or antibodies further enhances the attractiveness of GPR56 as a cancer therapeutic target, particularly for tumors with elevated GPR56 expression.

How might Gpr56-targeted therapeutics be developed and what potential side effects require consideration?

Development of Gpr56-targeted therapeutics could proceed through several complementary approaches:

Therapeutic ApproachDescriptionPotential ApplicationsDevelopment Considerations
Small moleculesCompounds targeting the orthosteric or allosteric binding sitesCancer, depression, muscle wastingHTS identified first-in-class partial agonist (3aDOG) and antagonist (DHM)
Peptide agonistsBased on tethered peptide sequenceAntidepressant effects, muscle enhancementHave shown antidepressant-like effects and upregulate AKT/GSK3/EIF4 pathways
Antibody therapeuticsTarget specific domains to modulate functionCancer, immune modulationCould exploit expression differences between normal and diseased tissues
RNA therapeuticssiRNA or antisense oligonucleotidesOncology applicationsDemonstrated efficacy in xenograft models

Potential side effects requiring careful monitoring include:

  • Neurodevelopmental concerns: Given GPR56's critical role in brain development and its association with bilateral frontoparietal polymicrogyria when mutated , developmental exposure should be avoided.

  • Muscle physiology impacts: Antagonists might impair adaptive responses to exercise given Gpr56's role in muscle hypertrophy .

  • Immune function: GPR56 expression on immune cells including NK cells and T lymphocytes suggests potential immunomodulatory effects .

  • Tissue architecture: As Gpr56 interacts with extracellular matrix components, effects on tissue organization and remodeling require evaluation.

Encouragingly, the apparent absence of major physiological defects in adult human tissues lacking GPR56 suggests a potential therapeutic window, particularly for time-limited interventions in adult patients.

How does the unique tethered-peptide-agonist activation mechanism of Gpr56 function?

Gpr56 employs a distinctive activation mechanism characteristic of adhesion GPCRs that involves autoproteolysis and exposure of a self-activating peptide:

  • Autoproteolysis: The GAIN domain catalyzes self-cleavage of Gpr56, splitting it into an extracellular N-terminal fragment (NTF) and a membrane-spanning C-terminal fragment (CTF) that remain non-covalently associated .

  • Tethered peptide formation: The cleavage generates a short extracellular sequence on the CTF termed the "tethered-peptide-agonist" .

  • Activation trigger: Mechanical forces or other stimuli can cause dissociation of the NTF, exposing the tethered-peptide-agonist .

  • Self-activation: The exposed tethered peptide binds to its orthosteric pocket within the receptor structure, triggering conformational changes that activate G-protein signaling .

This mechanism has been leveraged experimentally through engineered receptors with modified tethered-peptide-agonists. For example, the GPR56 A386M construct has a truncated tethered-peptide-agonist for antagonist screening, while GPR56 7TM has an intact tethered-peptide-agonist for agonist screening . Understanding this activation process is crucial for developing effective modulators and interpreting experimental results.

What is the relationship between Gpr56 and integrin-mediated signaling in cancer progression?

Gpr56 appears to interface significantly with integrin-mediated signaling in cancer, affecting cell adhesion and survival:

  • Pathway crosstalk: Expression profiling of GPR56-silenced cancer cells revealed altered expression of genes specifically involved in integrin-mediated signaling pathways .

  • Adhesion regulation: GPR56 silencing reduces cancer cell adhesion to extracellular matrix components, a process primarily mediated by integrins .

  • Anoikis sensitivity: The reduction in adhesion following GPR56 silencing leads to increased anoikis (detachment-induced apoptosis), a critical barrier to metastasis that cancer cells typically overcome .

  • Anchorage independence: GPR56 appears to support anchorage-independent growth, a hallmark of malignant transformation, potentially through integrin-related signaling .

  • Tetraspanin interactions: GPR56 activation in melanoma cells increases IL-6 secretion in a CD9/CD81-dependent manner , suggesting complex interactions with the tetraspanin-enriched microdomains that also contain integrins.

These findings suggest that Gpr56 may promote cancer progression partly through enhancing integrin-mediated adhesion signaling, thereby supporting cell survival and growth in conditions that would normally trigger anoikis. This mechanism helps explain how Gpr56 silencing leads to tumor regression in xenograft models and positions it as a potential therapeutic target in cancer contexts.

What is known about the involvement of Gpr56 in AKT/GSK3/EIF4 pathways related to depression?

Gpr56 has emerged as an important regulator of the AKT/GSK3/EIF4 signaling axis in the context of depression and antidepressant response:

  • Pathway activation: GPR56 peptide agonists upregulate the AKT/GSK3/EIF4 pathway , which is a key mediator of neuroplasticity and cellular resilience.

  • Depression mechanism: Chronic stress downregulates Gpr56 in the prefrontal cortex, which may impair this signaling cascade, contributing to depression pathophysiology .

  • Antidepressant action: Effective antidepressant treatment normalizes Gpr56 expression and subsequently restores pathway function specifically in responder subjects .

  • Treatment resistance: Gpr56 knockdown in mouse prefrontal cortex reduces behavioral response to antidepressant treatment, potentially by preventing proper activation of this signaling pathway .

  • Convergent mechanisms: Many traditional antidepressants ultimately affect components of this pathway, suggesting Gpr56 may represent a novel entry point to a critical signaling network.

The AKT/GSK3/EIF4 pathway promotes protein synthesis necessary for synaptic plasticity and neuronal adaptation. Through its regulation of this pathway, Gpr56 may influence the brain's ability to adapt to stress and respond to therapeutic interventions. This mechanistic understanding provides a rationale for developing Gpr56-targeted approaches for treatment-resistant depression.

What methodological approaches are most reliable for quantifying Gpr56 protein levels in research specimens?

Reliable quantification of Gpr56 protein levels requires consideration of its unique processing and expression characteristics:

  • Western blotting considerations: Due to the self-cleavage of Gpr56, antibodies must be carefully selected to detect either the full-length protein, the NTF, or the CTF, depending on the research question. Optimized lysis conditions are essential to preserve the membrane-associated CTF.

  • Flow cytometry applications: Validated antibodies such as clone CG4.rMAb specifically bind to GPR56 and perform effectively in flow cytometry applications . This approach is particularly valuable for immune cells and can detect cell surface expression levels.

  • Immunohistochemistry challenges: Verifying antibody specificity using appropriate knockout controls is crucial, as GPCR antibodies often show cross-reactivity. Antigen retrieval methods may need optimization for detecting membrane proteins like Gpr56.

  • Mass spectrometry approaches: For absolute quantification, targeted mass spectrometry using selected reaction monitoring (SRM) with isotope-labeled peptide standards can provide highly accurate measurements of Gpr56 and its processed fragments.

For optimal results, researchers should employ multiple complementary techniques and include appropriate positive and negative controls, particularly considering that expression levels and processing may vary across tissues and experimental conditions.

What experimental designs best demonstrate the functional consequences of Gpr56 modulation?

Effective experimental designs for demonstrating Gpr56 functional consequences include:

  • Loss-of-function approaches:

    • RNA interference using validated siRNA or shRNA sequences has successfully demonstrated Gpr56's role in cancer cell survival and anchorage-independent growth .

    • Conditional knockouts using Cre-loxP systems enable tissue-specific and temporally controlled deletion.

    • Pharmacological inhibition using identified antagonists like dihydromunduletone (DHM) .

  • Gain-of-function approaches:

    • Overexpression of Gpr56 cDNA has demonstrated effects on foci formation in fibroblasts and antidepressant-like behavioral effects when expressed in the prefrontal cortex .

    • Peptide agonists based on the tethered-peptide sequence activate Gpr56 signaling .

    • Small molecule agonists like 3-a-acetoxydihydrodeoxygedunin (3aDOG) .

  • Functional readouts:

    • In muscle research: measures of hypertrophy, IGF-1 expression, and protein synthesis rates .

    • In cancer studies: anchorage-independent growth, cell adhesion assays, and anoikis assessment .

    • In depression models: behavioral tests (forced swim test, tail suspension test), along with measurements of AKT/GSK3/EIF4 pathway activation .

    • For mechanistic studies: SRE-Luc reporter assays to measure G12/13 pathway activation .

To establish causality, rescue experiments are particularly valuable, where a phenotype induced by Gpr56 knockdown is reversed by re-expression of wild-type Gpr56 but not by functionally impaired mutants.

What are the most promising future directions for Gpr56 research in therapeutic development?

Several promising directions for Gpr56 research hold particular potential for therapeutic development:

  • Depression treatment:

    • Development of blood-based GPR56 expression assays as predictive biomarkers for antidepressant response could enable personalized treatment approaches .

    • Further characterization of GPR56 peptide agonists that demonstrate antidepressant-like effects by upregulating AKT/GSK3/EIF4 pathways .

    • Combination approaches targeting Gpr56 alongside traditional antidepressants to overcome treatment resistance.

  • Cancer therapeutics:

    • Advancement of Gpr56-targeting antibodies or small molecules into preclinical development for cancers with elevated GPR56 expression .

    • Development of combination therapies that simultaneously target Gpr56 and integrin-mediated adhesion pathways to maximize anoikis induction .

    • Exploration of Gpr56 as a biomarker to identify tumors likely to respond to adhesion-targeting therapies.

  • Muscle wasting disorders:

    • Design of Gpr56 agonists that enhance the muscle hypertrophy response to exercise, potentially beneficial in sarcopenia or muscle-wasting conditions .

    • Investigation of Gpr56's interaction with the PGC-1α4 pathway to develop integrated approaches for preserving muscle mass .

  • Technical innovations:

    • Development of improved screening systems for identifying more potent and selective Gpr56 modulators .

    • Creation of conditional and tissue-specific Gpr56 knockout and knock-in mouse models for refined mechanistic studies.

    • Application of cryo-electron microscopy to determine the three-dimensional structure of Gpr56 in various activation states.

These research directions could significantly advance our understanding of Gpr56 biology while creating new therapeutic opportunities across multiple disease areas.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.