Recombinant Mouse G-protein coupled receptor family C group 5 member B (Gprc5b)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Gprc5b

Recombinant Gprc5b is generated by expressing the Gprc5b gene in heterologous systems such as E. coli, insect cells, or mammalian cell lines . The protein contains a 7-transmembrane domain structure typical of GPCRs and undergoes post-translational modifications like glycosylation, which affects its localization and function . Its UniProt ID is Q9NZH0, and it has a molecular weight of ~43.9 kDa (including purification tags) .

Vascular Regulation

Gprc5b modulates vascular smooth muscle cell (SMC) contractility by interacting with the prostacyclin receptor (IP). Knockout (Gprc5b-KO) mice exhibit:

  • Enhanced IP-dependent cAMP production and vasorelaxation

  • Protection against hypertension due to increased IP membrane localization

  • Reduced atherosclerotic plaque formation via SMC differentiation stabilization .

Neurological Functions

Gprc5b is highly expressed in GABAergic neurons across brain regions such as the cerebellum, hippocampus, and hypothalamus . Key findings include:

  • Cerebellum: Enriched in Purkinje cells, influencing motor learning .

  • Hippocampus: Differential expression in dentate gyrus glutamatergic neurons, suggesting roles in spatial memory .

  • Hypothalamus: Higher expression in GABAergic vs. glutamatergic neurons (p < 0.001) .

Immune Modulation

In macrophages, Gprc5b deficiency increases phagocytosis and bacterial clearance efficiency. Studies using M-G5b-KO mice demonstrated:

  • Reduced bacterial load in peritonitis models

  • Enhanced EP2 receptor-mediated anti-inflammatory signaling .

Applications in Biomedical Research

Recombinant Gprc5b is utilized to study:

  • Hypertension and Atherosclerosis: Mechanisms of IP receptor trafficking in SMCs .

  • Neuropsychiatric Disorders: Associations with ADHD and depression via GABAergic signaling pathways .

  • Metabolic Diseases: Links to obesity and insulin resistance .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery timeframes, please consult your local distributor.
Note: Our proteins are standardly shipped with normal blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Gprc5b; Raig2; G-protein coupled receptor family C group 5 member B; Retinoic acid-induced gene 2 protein; RAIG-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-410
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
ENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALITLLLMLILLVRLPFIKDKE RKRPVCLHFLFLLGTLGLFGLTFAFIIQMDETICSIRRFLWGVLFALCFSCLLSQAWRVR RLVRQGTSPASWQLVSLALCLMLVQVIIATEWLVLTVLRDTKPACAYEPMDFVMALIYDM VLLAITLAQSLFTLCGKFKRWKVNGAFILVTTFLSALIWVVWMTMYLFGNSLIKQGDAWS DPTLAITLAASGWVFVIFHAIPEIHYTLLPPLQENPPNYFDTSQPRMRETAFDEEMHLPR AYMENKAFSMDEHNAALRSAVGFSNGSLEQRSSSLGKKPSSLGNRPSAPFRSNVYQPTEM AVVLNGGTIPTAPPSHTGRHHW
Uniprot No.

Target Background

Function
The exact function of this retinoic acid-inducible G-protein coupled receptor remains unknown. However, it provides evidence suggesting a potential interaction between retinoid and G-protein signaling pathways.
Gene References Into Functions
  1. In Gprc5b(-/-) mice, long-term motor learning was impaired in both the rotarod test and the horizontal optokinetic response eye movement (HOKR) test. PMID: 29481883
  2. The G protein-coupled receptor GPRC5B contributes to neurogenesis in the developing mouse neocortex. PMID: 24089469
  3. GPRC5B activates obesity-associated inflammatory signaling in adipocytes. PMID: 23169819
  4. GPRC5B plays significant roles in animal behavior regulated by the central nervous system. PMID: 21840300
  5. Gprc5b-v2 potentially contributes to brain maturation and function in mature brains, possibly through the regulation of neuronal morphology and protein-protein interactions. PMID: 20436672
  6. GPRC5B is involved in retinoic acid-dependent morphogenesis/angiogenesis and the regulation of extracellular matrix synthesis in the murine placenta and yolk sac. PMID: 17652913

Show More

Hide All

Database Links

KEGG: mmu:64297

UniGene: Mm.103439

Protein Families
G-protein coupled receptor 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is GPRC5B and what distinguishes it from other GPCRs?

    GPRC5B is an orphan G protein-coupled receptor belonging to the family C group 5 of receptors. Unlike typical family C GPCRs, GPRC5B contains unusually short extracellular amino-terminal domains (ATDs), which distinguishes it from other members. The term "orphan" indicates its endogenous ligand remains unknown or debated. GPRC5B shares approximately 30-40% sequence homology with other GPRC5 receptors and about 25% homology with other family C members . To study GPRC5B's distinct characteristics, researchers typically perform sequence alignment and phylogenetic analyses using tools like MUSCLE or Clustal Omega, comparing the protein against other family C GPCRs to identify conserved and divergent domains.

  • Where is GPRC5B expressed in mouse tissues and how is expression quantified?

    GPRC5B shows robust expression across various tissues with notable enrichment in the central nervous system. Research methodologies for quantifying expression include:

    • RNA analysis: RNAscope in situ hybridization effectively visualizes Gprc5b mRNA in tissue sections

    • Protein detection: Western blotting using validated antibodies (e.g., polyclonal antibodies against GPRC5B)

    • Flow cytometry: For cellular expression studies, particularly in transfected cell lines

    Current research shows GPRC5B is abundantly expressed in the cerebellum, motor cortex, medial prefrontal cortex, and hippocampus, with particularly high expression in GABAergic neurons. Expression profiling studies have also identified GPRC5B in adipose tissue, pancreatic islets, and cardiac tissue .

  • How does GPRC5B expression vary across neuronal populations?

    GPRC5B exhibits differential expression across neuronal populations that can be quantified using dual in situ hybridization:

    Brain RegionGlutamatergic Neurons (% expressing Gprc5b)GABAergic Neurons (% expressing Gprc5b)Expression Comparison
    mPFC71%85%Higher in GABAergic
    mCTX61%82%Higher in GABAergic
    Dentate GyrusHigh expressionLower expressionHigher in glutamatergic

    For expression analysis, researchers employ RNAscope dual in situ hybridization with Slc17a7 as a marker for glutamatergic neurons, Gad1 for GABAergic neurons, and Chat for cholinergic neurons. Quantification typically involves calculating the ratio of dot signals within each cell to the area of the identified mask, followed by statistical analysis using the Wilcoxon-Rank Sum two-sided test .

  • What developmental patterns does GPRC5B expression follow?

    GPRC5B expression varies throughout development, with studies showing approximately 50% lower expression in islets from newborn mice (<3 weeks) compared to adult mice (>36 weeks) . In the central nervous system, Gprc5b enrichment in neurogenic regions such as subependymal zone (SEZ), subventricular zone (SVZ), and subgranular zone (SGZ) suggests involvement in adult neurogenesis .

    To study developmental expression patterns, researchers typically use:

    • Age-matched tissue sampling at defined developmental timepoints

    • Quantitative RT-PCR for temporal expression profiling

    • Immunohistochemistry with age-specific controls

    • Comparison with developmental markers to correlate expression with specific developmental processes

Advanced Research Questions

  • What methods are most effective for studying GPRC5B post-translational modifications and their functional significance?

    GPRC5B undergoes extensive glycosylation that affects its function and localization. To study these modifications:

    1. Glycosylation analysis:

      • Treat samples with endoglycosidases (PNGase F, Endo H) followed by Western blot to detect mobility shifts

      • Use site-directed mutagenesis to alter potential glycosylation sites and assess functional consequences

      • Apply lectin-based affinity purification to isolate glycosylated forms

    2. Protein fractionation:

      • Employ subcellular fractionation to isolate membrane, cytosolic, and post-synaptic density fractions

      • Use density gradient centrifugation to separate differentially modified forms

    3. Mass spectrometry:

      • Perform LC-MS/MS analysis after immunoprecipitation to identify specific modifications

      • Use glycopeptide enrichment techniques prior to mass spectrometry

    Research has demonstrated high levels of GPRC5B glycosylation both in transfected cells and in mouse brain, suggesting this modification is critical for proper protein function and trafficking .

  • How should researchers analyze kinetic signaling data for GPRC5B?

    Due to its orphan status, analyzing GPRC5B signaling kinetics requires specialized approaches:

    1. Time-course signal profiling:

      • Design experiments to capture complete signaling curves (straight line, association exponential, rise-and-fall to zero, or rise-and-fall to steady-state)

      • Collect data points across appropriate time intervals based on expected receptor desensitization rates

    2. Analysis frameworks:

      • Employ model-free approach: Fit data to general time course equations using software like GraphPad Prism

      • Apply mechanistic approach: Fit data to equations derived from enzyme kinetics incorporating receptor desensitization

    3. Parameter derivation:

      • Calculate initial rate of signaling by agonist-occupied receptor (kτ) as the primary efficacy parameter

      • Determine regulation parameters including receptor desensitization rate constants

    This approach extends classical pharmacological analysis to kinetic data, allowing quantification of both signaling efficacy and regulation of signaling mechanisms .

  • What are the methodological approaches for investigating GPRC5B's role in insulin secretion and diabetes?

    GPRC5B is implicated in pancreatic β-cell function and insulin secretion. To study its role:

    1. Expression manipulation:

      • Use lentiviral shRNA for targeted Gprc5b knockdown in isolated islets

      • Apply CRISPR-Cas9 for gene editing in β-cell lines

    2. Functional assays:

      • Conduct glucose-stimulated insulin secretion (GSIS) tests at varying glucose concentrations (e.g., 1 mmol/L and 20 mmol/L)

      • Examine glutamate potentiation of insulin secretion

      • Perform apoptosis assays (e.g., cytokine-induced apoptosis in MIN6 cells)

    3. Expression correlation:

      • Compare GPRC5B levels between diabetic and non-diabetic islet samples

      • Analyze age-dependent expression changes

    Research has demonstrated that GPRC5B mRNA and protein are upregulated 2.5-fold in islets from donors with type 2 diabetes, and that shRNA-mediated downregulation increases both basal and glucose-stimulated insulin secretion, suggesting GPRC5B as a potential therapeutic target .

  • How can researchers effectively identify neuronal circuits and functions influenced by GPRC5B?

    To elucidate GPRC5B's role in specific neural circuits:

    1. Circuit mapping approaches:

      • Employ cell-type specific conditional knockout models (e.g., using Cre-loxP system)

      • Utilize chemogenetic or optogenetic techniques in combination with GPRC5B manipulation

    2. Behavioral assays:

      • Conduct motor coordination tests when studying cerebellar circuits

      • Perform spatial memory assessments for hippocampal functions

      • Use anxiety and depression behavioral paradigms based on GPRC5B's potential role in mood disorders

    3. Electrophysiology:

      • Record from specific neuronal populations with confirmed GPRC5B expression

      • Analyze synaptic plasticity parameters including long-term potentiation and depression

    4. Imaging approaches:

      • Apply calcium imaging to monitor activity in GPRC5B-expressing neurons

      • Use high-resolution microscopy to study GPRC5B localization at synapses

    Existing research has demonstrated GPRC5B's importance in cerebellar Purkinje cell development, specifically in distal axon development and synaptic formation with cerebellar nuclear neurons, suggesting its critical role in motor learning and coordination .

  • What strategies show promise for identifying GPRC5B's endogenous ligand?

    As an orphan receptor, identifying GPRC5B's endogenous ligand remains a key research challenge:

    1. Functional screening approaches:

      • Develop cell-based assays with GPRC5B-overexpressing reporter cell lines monitoring multiple signaling pathways (cAMP, calcium mobilization, ERK1/2 phosphorylation)

      • Screen tissue extracts, particularly from brain regions with high GPRC5B expression

      • Employ reverse pharmacology approaches testing candidate compounds based on structural predictions

    2. Computational methods:

      • Use molecular docking simulations with predicted binding pocket structures

      • Apply machine learning approaches to identify potential ligands based on structural similarity to known ligands of related receptors

    3. Affinity-based approaches:

      • Develop tagged GPRC5B constructs for pull-down assays to identify binding partners

      • Use photoaffinity labeling to capture transient interactions

    4. Proximity labeling techniques:

      • Apply BioID or APEX2 methodologies to identify proteins in close proximity to GPRC5B in its native environment

    The identification of GPRC5B's endogenous ligand would significantly advance understanding of this receptor's physiological roles and potential as a therapeutic target in neurological and metabolic disorders .

  • How should researchers approach studying GPRC5B in the context of neuropsychiatric disorders?

    Given GPRC5B's association with bipolar disorder, major depressive disorder, and ADHD:

    1. Genetic approaches:

      • Analyze GWAS data to identify specific GPRC5B variants associated with psychiatric conditions

      • Employ functional genomics to understand how intronic variants affect GPRC5B expression or splicing

    2. Patient-derived models:

      • Generate induced pluripotent stem cells (iPSCs) from patients with relevant GPRC5B variants

      • Differentiate iPSCs into neurons to study cellular phenotypes

    3. Transcriptomic analysis:

      • Compare GPRC5B expression in post-mortem brain samples from affected individuals versus controls

      • Conduct single-cell RNA sequencing to identify cell-type specific alterations

    4. Animal models:

      • Create transgenic mouse models expressing human GPRC5B variants

      • Apply behavioral testing protocols relevant to the specific disorder being studied

    Current research indicates that GPRC5B may be involved in bipolar disorder and major depressive disorder signaling pathways, and GWAS studies have identified intronic regions of GPRC5B potentially involved in ADHD etiology .

Data Interpretation Questions

  • How should researchers interpret contradictory findings about GPRC5B function across different tissues?

    GPRC5B exhibits diverse functions across neural, metabolic, and cardiovascular systems. To reconcile contradictory findings:

    1. Systematic comparison framework:

      • Create a structured analysis table comparing experimental conditions, models, and readouts

      • Identify key variables that differ between studies (species, cell types, developmental stages)

    2. Context-dependent analysis:

      • Consider tissue-specific interaction partners that may modulate GPRC5B function

      • Analyze cell-type specific signaling networks that may influence outcomes

    3. Methodological evaluation:

      • Assess antibody specificity and validation methods used in different studies

      • Consider limitations of knockout models (compensatory mechanisms, developmental effects)

    4. Integrated hypothesis development:

      • Develop testable hypotheses that could explain tissue-specific functions

      • Design experiments specifically addressing contextual differences

    For example, GPRC5B shows seemingly opposite effects in different tissues: in adipose tissue it promotes inflammatory signaling linked to insulin resistance, while in pancreatic β-cells its downregulation enhances insulin secretion. These findings can be reconciled by considering tissue-specific signaling pathways and interaction partners .

  • What are the best practices for validating antibodies and tools for GPRC5B research?

    Robust validation is essential for reliable GPRC5B research:

    1. Antibody validation protocol:

      • Test specificity using GPRC5B knockout or knockdown controls

      • Verify reactivity in heterologous expression systems (e.g., HEK293 cells transfected with GPRC5B)

      • Perform peptide competition assays

      • Confirm concordance between protein and mRNA expression patterns

    2. Recombinant protein validation:

      • Verify protein expression and purification by SDS-PAGE

      • Confirm proper folding using circular dichroism or limited proteolysis

      • Test functional activity in appropriate bioassays

    3. Cross-reactivity assessment:

      • Test against closely related family members (GPRC5A, GPRC5C, GPRC5D)

      • Validate species cross-reactivity if using across different model organisms

    4. Documentation standards:

      • Record comprehensive validation data including positive and negative controls

      • Document lot-to-lot variation for antibodies

      • Maintain detailed protocols for reproducibility

    The development and validation of new GPRC5B polyclonal antibodies has been instrumental in advancing expression profiling studies, as demonstrated in recent research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.