Recombinant Mouse Gamma-secretase subunit APH-1A (Aph1a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for precise delivery estimates.
Note: All our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it for you.
Synonyms
Aph1a; Gamma-secretase subunit APH-1A; APH-1a; Aph-1alpha
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGAAVFFGCTFVAFGPAFSLFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ RSLSCRRQEDSRVMVYSALRIPPED
Uniprot No.

Target Background

Function
APH-1A (Aph1a) is the non-catalytic subunit of the gamma-secretase complex. This complex is an endoprotease essential for the intramembrane cleavage of integral membrane proteins, such as Notch receptors and APP (amyloid-beta precursor protein). Aph1a is crucial for the proper assembly of the gamma-secretase complex. The gamma-secretase complex is involved in Notch and Wnt signaling pathways, regulating downstream processes through its role in processing key regulatory proteins and influencing cytosolic CTNNB1 levels.
Gene References Into Functions
  1. Leda-1/Pianp is constitutively processed by proprotein convertases, sheddases including MMPs and ADAM10/17, and intramembrane protease gamma-secretase. PMID: 27349870
  2. Efficiency of beta-arrestin1 or inhibition of binding of beta-arrestin1 with APH-1 by small peptides reduced Abeta production without affecting Notch processing. PMID: 23208420
  3. Pen-2, along with nicastrin and Aph-1alpha, is dispensable for presenilin endoproteolysis. PMID: 22973949
  4. Aph-1 directly associates with full-length and C-terminal fragments of gamma-secretase substrates. PMID: 20145246
  5. Presenilin 1 (PS1)-derived fragments, mature nicastrin, APH-1, and PEN-2, associate with cholesterol-rich detergent insoluble membrane (DIM) domains of both non-neuronal cells and neurons. PMID: 15322084
  6. Our findings demonstrate that APH-1a is the primary mammalian APH-1 homolog present in presenilin-dependent gamma-secretase complexes during embryogenesis. PMID: 15634781
  7. Nct plays a critical role in the stability and proper intracellular trafficking of other components of the PS1/ gamma-secretase complex but not in maintaining the association of PEN-2, APH-1, and full-length PS1. PMID: 15711015

Show More

Hide All

Database Links
Protein Families
APH-1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein.

Q&A

What is Aph1a and what is its functional role in the γ-secretase complex?

Aph1a is one of the four essential subunits of the γ-secretase protease complex, alongside Presenilin, Pen2, and Nicastrin. This complex is responsible for the proteolytic processing of multiple transmembrane proteins, most notably amyloid precursor protein (APP) in the context of Alzheimer's disease pathology. The γ-secretase complex is also critical for Notch, N-Cadherin, and potentially other signaling pathways during development and in adult tissues . Aph1a specifically contributes to the stability and assembly of the γ-secretase complex, with its absence causing destabilization of other complex components as demonstrated in knockout models . The specific stoichiometry and arrangement of Aph1a within the complex is crucial for proper enzymatic function and substrate recognition.

How do Aph1 genes differ between humans and rodents?

In humans, two distinct genes encode Aph1A and Aph1B proteins. Rodents possess an additional gene, Aph1C, which arose through a duplication of the Aph1B gene, resulting in three separate Aph1 genes . This evolutionary difference means that rodents can form at least six distinct γ-secretase complexes, while humans can form four different complexes based on the combinatorial assembly of different subunit isoforms . The high similarity between Aph1B and Aph1C in rodents (96.3% at the nucleotide level) suggests functional redundancy, which is supported by the observation that single knockouts of either gene produce viable offspring with no gross phenotypic abnormalities . This genetic difference must be considered when using mouse models to study human γ-secretase biology.

What phenotypic consequences result from Aph1a gene inactivation in mice?

Aph1A knockout (Aph1A-/-) mice exhibit an embryonic lethal phenotype characterized by:

  • Angiogenesis defects in the yolk sac

  • Neuronal tube malformations

  • Mild somitogenesis defects

  • Increased apoptosis in neural tissues

  • Neuroepithelial cell emigration from the neural tube

How does the expression pattern of Aph1a correlate with its function during development?

In situ hybridization experiments on mouse embryos have revealed that Aph1a expression largely overlaps with other γ-secretase components (Presenilin1, Pen2, and Nicastrin) in the yolk sac and embryo proper . This co-expression pattern supports the coordinated function of these proteins in the γ-secretase complex. The strong expression of Aph1a in tissues with severe phenotypic defects in knockout models (such as yolk sac and neural tube) corresponds to its critical developmental functions in these specific tissues. This expression pattern helps explain the tissue-specific effects observed when different Aph1 components are genetically inactivated and supports the concept that different γ-secretase complexes may have distinct tissue-specific roles during development .

What methodologies are recommended for studying Aph1a phosphorylation patterns?

For comprehensive analysis of Aph1a phosphorylation patterns, researchers should employ a multi-methodological approach:

  • LC-MS/MS Analysis: Label-free liquid chromatography with tandem mass spectrometry on phosphopeptide-enriched trypsin digests of Aph1a expressed in cell models provides the most definitive identification of phosphorylation sites . This approach enables identification of specific phosphorylated residues, particularly in the second intracellular loop (ICL2) and C-terminus of Aph1a.

  • Phosphorylation-site Prediction Algorithms: Tools such as NetPhos can be used to predict potential phosphorylation sites based on protein sequence analysis . These predictions should be confirmed experimentally.

  • GRK Inhibition Studies: Selective inhibitors like CMPD101 (for GRK2/3) can help determine the contribution of specific GRK isoforms to Aph1a phosphorylation . Measuring the changes in phosphorylation patterns after inhibitor treatment can reveal kinase-specific sites.

  • Site-directed Mutagenesis: Generating serine/threonine to alanine mutations at predicted phosphorylation sites, followed by functional assays, can confirm the biological significance of specific phosphorylation events.

  • PathHunter βarr2 Recruitment Assay: This technique is valuable for measuring how phosphorylation affects the interaction between Aph1a and β-arrestin 2, a key regulatory interaction .

Researchers should note that GRKs 2, 3, 5, and 6 have been shown to impart distinct phosphorylation patterns within ICL2 and the C-terminus of Aph1a, differentially regulating γ-secretase activity and Aβ generation .

How do GPCR kinases (GRKs) regulate Aph1a function through phosphorylation?

GRKs generate a specific "phosphorylation barcode" on Aph1a that regulates its interaction with β-arrestin 2 (βarr2) and consequently modulates γ-secretase activity. Research has shown that:

  • GRKs 2, 3, 5, and 6 phosphorylate distinct patterns of serine and threonine residues within ICL2 and the C-terminus of Aph1a .

  • This differential phosphorylation directly influences βarr2 recruitment to Aph1a. For example, inhibition of GRK2/3 with CMPD101 significantly increases βarr2 recruitment to Aph1a .

  • The GRK-mediated phosphorylation and subsequent βarr2 interaction affect γ-secretase activity and Aβ generation in neural progenitor cells, making this regulatory mechanism relevant to Alzheimer's disease pathophysiology .

  • The phosphorylation sites in Aph1a are analogous to those found in GPCRs, suggesting evolutionary conservation of this regulatory mechanism .

This kinase-specific regulation provides a potential mechanism for fine-tuning γ-secretase activity in different cellular contexts and offers novel targets for therapeutic intervention in Alzheimer's disease.

What is the structural basis for β-arrestin 2 interaction with Aph1a?

Molecular dynamics (MD) simulations and structural modeling have revealed several key features of the β-arrestin 2 (βarr2) interaction with Aph1a:

  • The finger loop region of βarr2 specifically engages with both the second and third intracellular loops (ICL2 and ICL3) of Aph1a . This interaction mode facilitates the stabilization of the complex.

  • The conformation of the βarr2-Aph1a complex closely resembles a fully engaged GPCR-β-arrestin complex . This structural similarity suggests conserved mechanisms of interaction despite Aph1a not being a canonical GPCR.

  • Phosphorylation of specific residues in ICL2 and the C-terminus of Aph1a creates binding sites for the positively charged regions of βarr2, similar to how phosphorylated GPCRs interact with arrestins .

  • The interaction likely involves conformational changes in both proteins, with the flexible regions of Aph1a adopting specific conformations upon βarr2 binding.

This structural understanding provides insight into how βarr2 recruitment to Aph1a may regulate γ-secretase complex assembly or activity and offers potential targets for structure-based drug design aimed at modulating this interaction.

What are the functional differences between Aph1a-containing and Aph1bc-containing γ-secretase complexes?

The functional differences between Aph1a and Aph1bc-containing complexes have significant implications for both development and disease:

FeatureAph1a-containing complexesAph1bc-containing complexes
Developmental roleEssential for embryonic development, particularly in angiogenesis and neurogenesis Non-essential for development; knockouts are viable and fertile
Tissue specificityBroadly expressed with critical functions in yolk sac and neural tube More abundant in adult brain regions including brainstem and olfactory bulb
Effect on APP processingSevere reduction (~70%) in γ-secretase activity toward APP in knockout fibroblasts Region-specific effects in adult brain; significant reduction in APP processing in brainstem and olfactory bulb
Notch signaling impactSevere reduction, comparable to APP processing defects Less characterized but appears less critical than Aph1a complexes
CompensationCannot be compensated by Aph1bc expression Potentially compensated by Aph1a in some contexts
Therapeutic targetingHigh risk of developmental and functional side effects Potentially safer target for reducing Aβ production

These differences suggest that the various γ-secretase complexes have evolved distinct functions that are particularly evident in specific tissues or developmental stages, supporting the concept that selective targeting of specific complex subtypes might offer therapeutic advantages .

What are the implications of targeting Aph1a versus Aph1bc for Alzheimer's disease therapy?

The distinct biological roles of different Aph1-containing γ-secretase complexes have important implications for therapeutic strategies in Alzheimer's disease:

These findings support the theoretical possibility that targeting specific γ-secretase subunit combinations could yield less toxic Alzheimer's disease therapeutics than currently available general inhibitors of γ-secretase activity .

What are the key controls needed when studying Aph1a function in cell culture systems?

When designing experiments to study Aph1a function in cell culture, researchers should implement the following controls:

  • Expression level verification: Western blotting to confirm appropriate expression levels of wild-type or mutant Aph1a, as overexpression may lead to non-physiological effects or improper complex assembly.

  • Complex formation assessment: Co-immunoprecipitation studies to verify that recombinant Aph1a properly incorporates into γ-secretase complexes with other subunits (Presenilin, Nicastrin, and Pen2).

  • Cell type considerations: Include multiple cell types in studies, as the research shows tissue-specific effects of Aph1a manipulation, with neural progenitor cells being particularly relevant for Alzheimer's disease research .

  • Genetic controls: Include Aph1a knockout cells reconstituted with wild-type Aph1a as positive controls when studying mutant forms.

  • Functional readouts: Measure multiple γ-secretase-dependent processes beyond APP processing, such as Notch signaling, to assess the breadth of functional effects. The evidence suggests that Aph1a deficiency affects both APP and Notch processing to a similar extent (~70% inhibition) .

  • Phosphorylation status: When studying phosphorylation-dependent regulation, include phosphomimetic (S/T to D/E) and phospho-deficient (S/T to A) mutations of key residues in ICL2 and the C-terminus to model different phosphorylation states .

How can researchers accurately measure changes in γ-secretase activity resulting from Aph1a manipulation?

To accurately assess the impact of Aph1a manipulation on γ-secretase activity, researchers should employ multiple complementary assays:

  • APP-CTF accumulation analysis: Western blotting to measure the accumulation of APP C-terminal fragments, which are direct substrates of γ-secretase. This method revealed >2-fold accumulation of APP-CTF in brainstem and olfactory bulb of Aph1BC-/- mice .

  • Aβ ELISA: Quantitative measurement of different Aβ species (Aβ40, Aβ42) in cell culture media or tissue extracts to assess the impact on APP processing.

  • Luciferase reporter assays: Transfection with UAS-luciferase reporter gene and APP or Notch reporter constructs containing Gal4-VP16 sequences in their cytoplasmic domains allows direct comparison of effects on different substrates. This approach demonstrated that Aph1a deficiency causes approximately 70% inhibition of both APP and Notch processing .

  • NICD Western blotting: Detection of the Notch intracellular domain to assess Notch processing as a complementary γ-secretase substrate.

  • βarr2 recruitment assay: For studies focused on regulatory mechanisms, the PathHunter βarr2 recruitment assay can measure how manipulation of Aph1a affects its interaction with β-arrestin 2, which in turn regulates γ-secretase activity .

  • In vitro γ-secretase activity assays: Using purified membrane preparations and fluorogenic substrates to measure enzymatic activity under controlled conditions.

  • Region-specific analysis: When working with brain tissue, separate analysis of different regions is essential, as Aph1BC deficiency shows region-specific effects on APP processing .

What approaches can resolve contradictory data regarding Aph1a function in different experimental systems?

When faced with contradictory results regarding Aph1a function across different experimental systems, researchers should implement the following strategies:

  • Systematic comparison of model systems: The different phenotypes observed between Aph1a and Presenilin knockouts suggest system-specific differences . Directly compare findings across multiple cell types, animal models, and experimental conditions to identify context-dependent effects.

  • Developmental timing considerations: The embryonic lethality of Aph1a-/- mice indicates critical developmental functions . Employ inducible knockout systems to distinguish between developmental and adult functions of Aph1a.

  • Complex composition analysis: Different γ-secretase complexes containing various Aph1 isoforms may have distinct functions . Use immunoprecipitation with isoform-specific antibodies followed by mass spectrometry to characterize complex composition in different tissues or experimental systems.

  • Substrate specificity assessment: Measure effects on multiple γ-secretase substrates simultaneously, as the relative impact on different substrates may vary across systems .

  • Phosphorylation status determination: The phosphorylation "barcode" on Aph1a created by different GRKs affects its function . Map the phosphorylation patterns in different experimental systems using phospho-specific antibodies or mass spectrometry.

  • Genetic background effects: In mouse models, controlled genetic backgrounds are essential as modifier genes may influence phenotypes. Use congenic strains or littermate controls to minimize these effects.

  • Cross-validation with human data: Where possible, validate findings in human-derived systems such as induced pluripotent stem cells from Alzheimer's disease patients or control subjects to bridge the gap between rodent models and human biology.

This multifaceted approach can help resolve apparent contradictions by revealing the context-specific regulation and function of Aph1a-containing γ-secretase complexes.

What are the most promising targets within the Aph1a regulatory network for therapeutic development?

Based on current research, several promising targets within the Aph1a regulatory network warrant further investigation for therapeutic development:

  • Specific GRK-mediated phosphorylation sites: The differential phosphorylation of Aph1a by GRKs 2, 3, 5, and 6 creates specific patterns that regulate γ-secretase activity . Targeting specific phosphorylation sites rather than the entire γ-secretase complex could allow for selective modulation of activity.

  • β-arrestin 2 interaction interface: The interaction between β-arrestin 2 and Aph1a regulates γ-secretase function . Small molecules or peptides that modulate this protein-protein interaction could offer a novel approach to controlling γ-secretase activity without complete inhibition.

  • Aph1bc-containing complexes: The viability of Aph1bc knockout mice suggests that targeting these complexes may have fewer side effects than targeting Aph1a-containing complexes . Region-specific effects of Aph1bc deficiency on APP processing in brainstem and olfactory bulb make this approach particularly interesting.

  • Complex-specific conformational epitopes: The different composition of γ-secretase complexes likely results in distinct conformational states that could be targeted by selective antibodies or small molecules.

  • Tissue-specific regulatory mechanisms: The differential effects of Aph1a and Aph1bc deficiency across tissues suggest tissue-specific regulatory mechanisms . Identifying and targeting these mechanisms could allow for spatially restricted modulation of γ-secretase activity.

  • Interaction with substrate-recruiting factors: Factors that specifically recruit APP to γ-secretase complexes containing specific Aph1 isoforms could offer highly selective targets for reducing Aβ generation without affecting processing of other substrates.

These approaches represent a shift from general γ-secretase inhibition toward selective modulation of specific complexes or regulatory mechanisms, potentially avoiding the toxicities associated with current γ-secretase inhibitors.

How might differential Aph1a complex composition contribute to tissue vulnerability in Alzheimer's disease?

The heterogeneity of γ-secretase complexes containing different Aph1 isoforms may contribute to the regional vulnerability observed in Alzheimer's disease pathology:

  • Region-specific expression patterns: The differential expression of Aph1 isoforms across brain regions may create vulnerability patterns. For example, the strong effect of Aph1bc deficiency on APP processing in brainstem and olfactory bulb suggests region-specific roles for these complexes .

  • Substrate processing efficiency: Different Aph1-containing complexes may process APP with varying efficiency or produce different ratios of Aβ species. Regions with higher expression of less efficient complexes might accumulate more APP-CTFs or produce more amyloidogenic Aβ species.

  • Interaction with disease-modifying factors: The composition of γ-secretase complexes may influence their interaction with other Alzheimer's disease-related factors, such as ApoE variants or tau. These interactions could amplify pathological processes in specific brain regions.

  • Regulation by tissue-specific phosphorylation patterns: The phosphorylation of Aph1a by region-specific expression patterns of GRKs could create vulnerability hotspots for dysregulated APP processing .

  • Compensation capacity: The ability of different brain regions to compensate for dysfunction in specific γ-secretase complexes may vary. The research shows that Aph1bc deficiency affects APP processing differently across brain regions, suggesting variable compensation by Aph1a-containing complexes .

  • Age-related changes in complex composition: The expression or regulation of different Aph1 isoforms may change with age, potentially explaining the late-onset nature of most Alzheimer's disease cases.

Understanding these mechanisms could help explain the selective vulnerability of specific brain regions in Alzheimer's disease and potentially identify novel therapeutic approaches targeting the most relevant γ-secretase complexes in vulnerable regions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.