Recombinant Mouse Gamma-secretase subunit APH-1B (Aph1b)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Gamma-secretase Subunit APH-1B

Recombinant Mouse Gamma-secretase subunit APH-1B refers to the laboratory-produced version of the anterior pharynx-defective 1B protein, a critical component of the gamma-secretase enzyme complex in mice. The gamma-secretase complex is a multi-subunit protease responsible for the final cleavage of Amyloid Precursor Protein (APP), releasing the Amyloid-beta (Aβ) peptides that accumulate in amyloid plaques characteristic of Alzheimer's Disease . This complex consists of four essential components: Presenilin (PS), which contains the catalytic site, Nicastrin (NCT), Presenilin Enhancer 2 (PEN2), and Anterior Pharynx-defective 1 (APH-1) .

The APH-1 protein exists in multiple isoforms, with APH-1B being one of the significant variants in mice. Within the gamma-secretase complex, APH-1B plays crucial roles in assembly, stability, and modulation of enzymatic activity. The recombinant form of this protein is produced using advanced molecular biology techniques to ensure proper folding and functionality, typically incorporating affinity tags to facilitate purification while preserving native structural characteristics.

Research utilizing Recombinant Mouse Gamma-secretase subunit APH-1B has been instrumental in uncovering the heterogeneity of gamma-secretase complexes and their differential contributions to Alzheimer's disease pathology. Unlike broad-spectrum approaches to gamma-secretase inhibition, studies with recombinant APH-1B have revealed the potential for selective targeting of specific gamma-secretase subtypes, potentially minimizing side effects associated with complete gamma-secretase inhibition .

Molecular Structure and Characteristics

The molecular structure of Recombinant Mouse Gamma-secretase subunit APH-1B exhibits distinct characteristics that contribute to its unique functional properties within the gamma-secretase complex. Advanced structural studies have provided detailed insights into the conformation and arrangement of APH-1B and its interactions with other subunits.

Primary Structure and Homology

Mouse APH-1B shares approximately 56% sequence identity with its paralog APH-1A, with mostly conservative substitutions distributed throughout the sequence . Despite this relatively high sequence similarity, critical structural differences exist between these isoforms that contribute to their distinct functional properties within the gamma-secretase complex. These sequence divergences are particularly concentrated in specific regions that interface with other subunits of the complex.

Three-dimensional Structure

Detailed structural analyses have identified specific regions where APH-1B differs significantly from APH-1A. In particular, three segments on the inner and outer membrane surfaces show local divergence, with changes mapping to the interface between APH-1B and Presenilin 1 (PSEN1) . The extracellular ends of the transmembrane helical pairs TM2-TM3 and TM6-TM7 are bent by 4° and 7° respectively in APH-1B compared to APH-1A . Additionally, the cytosolic TM3-TM4 connecting loop (residues 104-110) is partially disordered in APH-1B but fully resolved in APH-1A .

Table 1: Structural Comparison Between APH-1A and APH-1B

These structural differences are particularly significant as they coincide with local clusters of sequence divergence between the APH-1 isoforms and appear to influence the conformation of the catalytic PSEN1 subunit, thereby affecting the enzyme's activity and substrate processing .

Functional Role in Gamma-secretase Complex

Recombinant Mouse Gamma-secretase subunit APH-1B plays critical functional roles within the gamma-secretase complex that distinguish it from other APH-1 isoforms. Research using recombinant protein has revealed its specific effects on complex assembly, substrate processing, and potential relevance to Alzheimer's disease pathology.

Influence on Complex Conformation

Studies using recombinant APH-1B have demonstrated that this subunit directly influences the proteolytic activity of the gamma-secretase complex by affecting the conformation of the catalytic Presenilin 1 (PSEN1) subunit . When incorporated into gamma-secretase complexes, APH-1B induces a more "closed" conformation of PSEN1 compared to APH-1A-containing complexes, as measured by Fluorescent Lifetime Imaging Microscopy (FLIM) . This conformational difference is similar, though milder, to the effects observed with certain familial Alzheimer's disease-associated presenilin mutations that enhance the production of longer amyloid-beta peptides .

The structural basis for this conformational influence has been partially elucidated through cryo-EM studies of gamma-secretase complexes containing recombinant APH-1B. Significant conformational differences between GSEC1A (gamma-secretase with APH-1A) and GSEC1B (gamma-secretase with APH-1B) structures are observed in the catalytic PSEN1 subunit . For instance, in GSEC1B, the TM8-TM9 PSEN1 loop containing the conserved PAL motif is resolved, while it is not visible in GSEC1A structures . Various other structural elements, including the cytoplasmic ends of transmembrane helices, show different conformations depending on whether the complex contains APH-1A or APH-1B .

Effects on Substrate Processing

Functional studies with recombinant APH-1B have revealed distinctive patterns of substrate processing by gamma-secretase complexes containing this subunit. All APH-1 isoform-containing complexes support the production of APP intracellular domain (AICD) and Notch intracellular domain (NICD) through ε-cleavage, with similar kinetic parameters (Km and Vmax) observed for AICD production by both APH-1A and APH-1B-containing complexes .

Table 2: Functional Differences Between APH-1A and APH-1B Containing Gamma-Secretase Complexes

ParameterAPH-1A ComplexAPH-1B Complex
Km and Vmax for AICD productionSimilar to APH-1BSimilar to APH-1A
Production of longer Aβ species (Aβ1-42, Aβ1-45, Aβ1-46, Aβ1-49)Lower proportionHigher proportion
Production of shorter Aβ species (Aβ1-37, Aβ1-38, Aβ1-40)Higher proportionLower proportion
PS1 conformation (measured by FLIM)More "open" conformationMore "closed" conformation
Contribution to total γ-secretase activity in mouse brainLesser contributionSignificant contribution
Contribution to total γ-secretase activity in human brainLesser contributionMajor contributor

Production and Purification Methods

The production of high-quality Recombinant Mouse Gamma-secretase subunit APH-1B requires sophisticated methods to ensure proper protein folding, membrane integration, and functional integrity. Researchers have developed specialized techniques for expressing, purifying, and reconstituting this multi-pass transmembrane protein.

Expression Systems

Multiple expression systems have been employed for the production of recombinant mouse APH-1B, each with specific advantages for different research applications. Mammalian cell expression systems, including HEK293 and CHO cells, provide the appropriate cellular machinery for proper folding and post-translational modifications of this complex transmembrane protein. These systems are particularly valuable for functional studies where native-like protein conformation is essential.

Insect cell expression systems, typically utilizing baculovirus vectors, offer higher protein yields while maintaining most post-translational modifications and are often employed for structural studies requiring larger quantities of protein. For some applications, yeast expression systems or cell-free protein synthesis may also be utilized, though these approaches may require additional optimization to ensure proper folding of multi-pass transmembrane proteins like APH-1B.

Purification Strategies

Purification of recombinant mouse APH-1B presents significant challenges due to its hydrophobic nature and multiple transmembrane domains. Effective purification protocols typically involve a multi-step process beginning with careful cell lysis and membrane fraction isolation. Subsequent detergent solubilization extracts the protein from cellular membranes, with mild detergents like digitonin, DDM (n-dodecyl β-D-maltoside), or CHAPSO often employed to preserve protein structure and function.

Affinity chromatography using engineered tags (such as polyhistidine, FLAG, or streptavidin-binding peptide tags) provides an initial purification step with high selectivity. This is typically followed by additional chromatographic techniques such as size-exclusion chromatography to separate the protein of interest from aggregates and other impurities, and potentially ion-exchange chromatography for further purification.

Research Applications

Recombinant Mouse Gamma-secretase subunit APH-1B serves as a critical tool in various research applications, particularly in the investigation of Alzheimer's disease mechanisms and the development of potential therapeutic interventions.

Alzheimer's Disease Research

In Alzheimer's disease research, recombinant mouse APH-1B has been instrumental in investigating the heterogeneity of gamma-secretase complexes and their differential contributions to amyloid-beta production and processing. Studies utilizing recombinant APH-1B have demonstrated that gamma-secretase complexes containing this subunit produce a higher proportion of longer, more amyloidogenic Aβ species compared to complexes containing APH-1A .

Furthermore, research using genetic models and recombinant proteins has shown that APH-1B-containing gamma-secretase complexes contribute significantly to total gamma-secretase activity in both mouse and human brains . This finding, combined with the observation that deletion of APH-1B in mouse models of Alzheimer's disease significantly reduces amyloid burden and improves disease-related phenotypes without causing Notch-related side effects, highlights the potential of APH-1B as a therapeutic target .

Table 3: Effects of APH-1B Deletion in Mouse Alzheimer's Disease Models

ParameterControl Mice (APPPS1+/0; Aph1BC+/+)APH-1B Deficient Mice (APPPS1+/0; Aph1BC-/-)
Amyloid burden at 9 monthsMassiveSignificantly lowered
Aβx-40 accumulation in hippocampusHigherSignificantly decreased
Aβx-42 accumulation in hippocampusHigherSignificantly decreased
Notch-related side effectsNone observedNone observed
B- or T-cell maturationNormalUnaffected
Intestinal and pancreatic morphologyNormalUnaffected
Expression of Notch1 and target genesNormalSimilar to control

Drug Development

The distinct properties of gamma-secretase complexes containing APH-1B make this subunit an attractive target for selective therapeutic interventions in Alzheimer's disease. Recombinant mouse APH-1B has been essential for screening and developing compounds that selectively target APH-1B-containing gamma-secretase complexes, with the goal of reducing amyloid-beta production while avoiding the Notch-related side effects associated with broad-spectrum gamma-secretase inhibition .

Structural information derived from studies with recombinant APH-1B, particularly the identification of specific regions where APH-1B differs from APH-1A, provides potential binding sites for the development of selective inhibitors or modulators . This structure-based drug design approach represents a promising strategy for developing more specific and effective treatments for Alzheimer's disease.

Experimental Findings

Research utilizing Recombinant Mouse Gamma-secretase subunit APH-1B has yielded numerous significant findings that have advanced our understanding of gamma-secretase function and its role in Alzheimer's disease pathogenesis.

Biochemical Properties

In vitro studies comparing gamma-secretase complexes containing different recombinant APH-1 isoforms have revealed distinctive biochemical properties. While all complexes supported the production of APP intracellular domain (AICD) and Notch intracellular domain (NICD) through ε-cleavage with similar kinetic parameters, significant differences were observed in the spectrum of Aβ peptides produced . Specifically, APH-1B-containing complexes generated a higher proportion of longer, more amyloidogenic Aβ species (Aβ1-42, Aβ1-45, Aβ1-46, and Aβ1-49) compared to complexes containing APH-1A .

These findings were confirmed using multiple independent experimental approaches, including analyses of gamma-secretase activity in cell culture systems expressing recombinant APH-1 isoforms and in immunoprecipitated gamma-secretase complexes from mouse and human brain tissues . The consistent observation of altered Aβ peptide profiles across different experimental systems underscores the robust and physiologically relevant effect of APH-1B on gamma-secretase activity.

Therapeutic Potential

Perhaps the most significant finding from research using recombinant mouse APH-1B is the demonstration that specific targeting of APH-1B-containing gamma-secretase complexes can alleviate Alzheimer's disease-related phenotypes without causing the severe Notch-related side effects typically associated with broad gamma-secretase inhibition . In mouse models of Alzheimer's disease, deletion of APH-1B resulted in significantly reduced amyloid burden and improved functional outcomes without affecting Notch-dependent processes such as B- or T-cell maturation, intestinal and pancreatic morphology, or the expression of Notch target genes .

This selective effect is likely related to the differential expression patterns of APH-1 isoforms and Notch in various tissues. Expression analyses using in situ hybridization have shown that APH-1B is expressed in neurons in regions relevant for Alzheimer's disease, while Notch1 is predominantly expressed in non-neuronal and neuronal precursor cells, with expression patterns overlapping significantly with APH-1A but not APH-1B .

Therapeutic Implications

The research findings obtained using Recombinant Mouse Gamma-secretase subunit APH-1B have significant implications for therapeutic strategies targeting Alzheimer's disease and potentially other conditions involving gamma-secretase activity.

Selective Targeting Approach

One of the most promising therapeutic approaches suggested by studies with recombinant APH-1B is the selective inhibition of APH-1B-containing gamma-secretase complexes . This strategy offers the potential to reduce amyloid-beta production while avoiding the severe side effects associated with non-selective gamma-secretase inhibition, which typically disrupts Notch signaling and leads to gastrointestinal toxicity, immunosuppression, and other adverse effects .

The rationale for this selective targeting approach is supported by several key findings from research using recombinant APH-1B. First, APH-1B-containing gamma-secretase complexes contribute significantly to total gamma-secretase activity in both mouse and human brains . Second, these complexes produce a higher proportion of longer, more amyloidogenic Aβ species . Third, genetic deletion of APH-1B in mouse models of Alzheimer's disease significantly reduces amyloid burden and improves disease-related phenotypes without causing Notch-related side effects .

Advantages Over Previous Approaches

The therapeutic potential of selective APH-1B targeting is particularly significant given the historical challenges in gamma-secretase-targeted drug development. Multiple broad-spectrum gamma-secretase inhibitors have failed in clinical trials due to mechanisms-based toxicity related to Notch inhibition. The selective APH-1B targeting approach, informed by studies using recombinant mouse APH-1B, offers a potential solution to this long-standing challenge in Alzheimer's disease drug development.

Compared to other approaches for achieving selectivity in gamma-secretase modulation, such as substrate-targeting strategies or allosteric modulation, selective inhibition of APH-1B-containing complexes offers several potential advantages. It leverages the natural heterogeneity of gamma-secretase complexes to achieve specificity, targets a subunit with a significant contribution to pathological Aβ production, and has been validated in animal models to reduce amyloid pathology without causing Notch-related side effects .

Future Research Directions

Research using Recombinant Mouse Gamma-secretase subunit APH-1B continues to evolve, with several promising directions for future investigation that could further advance our understanding of gamma-secretase function and its therapeutic modulation.

Development of Selective Modulators

One important area for future research is the development of highly selective small-molecule inhibitors or modulators that specifically target APH-1B-containing gamma-secretase complexes. The structural differences identified between APH-1A and APH-1B, particularly at their interface with PSEN1, provide potential binding sites for such selective compounds . High-throughput screening assays using recombinant APH-1B could facilitate the identification of lead compounds, followed by structure-based optimization guided by the available high-resolution structures.

The development of selective APH-1B modulators would not only provide potential therapeutic candidates for Alzheimer's disease but would also serve as valuable research tools for further investigating the specific functions of different gamma-secretase complexes in various physiological and pathological contexts.

Mechanistic Investigations

The molecular mechanism by which APH-1B influences the conformation of PSEN1 and thereby affects the spectrum of Aβ peptides produced remains to be fully elucidated. Studies combining recombinant protein biochemistry, structural biology, and computational approaches could help clarify this important aspect of gamma-secretase function.

Additional mechanistic questions that warrant further investigation include the role of APH-1B in processing substrates other than APP, such as Notch, N-Cadherin, and various other signaling proteins. Comparative studies using recombinant APH-1A and APH-1B could reveal substrate-specific differences in processing efficiency and cleavage patterns that may have implications for both physiological functions and potential therapeutic applications.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the order method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life is influenced by storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Synonyms
Aph1b; Gamma-secretase subunit APH-1B; APH-1b; Aph-1beta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTAAVFFGCAFIAFGPALALYVFTIATDPLRVIFLIAGAFFWLVSLLLSSVFWFLVRVIT DNRDGPVQNYLLIFGVLLSVCIQELFRLAYYKLLKKASEGLKSINPEETAPSMRLLAYVS GLGFGIMSGVFSFVNTLSNSLGPGTVGIHGDSPQFFLNSAFMTLVVIMLHVFWGVVFFDG CEKNKWYTLLTVLLTHLVVSTQTFLSPYYEVNLVTAYIIMVLMGIWAFYVAGGSCRSLKL CLLCQDKDFLLYNQRSR
Uniprot No.

Target Background

Function

APH-1B is a likely subunit of the gamma-secretase complex, an intramembrane-cleaving protease responsible for processing integral membrane proteins, such as Notch receptors and amyloid-beta precursor protein (APP). It functions as a stabilizing cofactor for the presenilin homodimer, facilitating the formation of a stable gamma-secretase complex. Compared to APH1A, APH-1B is thought to be present in a smaller proportion of gamma-secretase complexes.

Gene References Into Functions

Related Research:

  1. Aph1B deficiency is linked to memory impairment. PMID: 26942869
  2. In neuronal cells, prostaglandin I2 accumulation activates PKA/CREB and JNK/c-Jun signaling pathways through phosphorylation, leading to increased APH-1α/1β expression. PMID: 27240539
  3. Elevated Aβ oligomers in cerebrospinal fluid (CSF) stimulate APH-1α/1β expression (by >2.5-fold), which enhances APP gamma-cleavage and Aβ deposition in Alzheimer's disease (AD) progression. PMID: 26293690
  4. Analysis of hippocampal circuitry through Aph1b-gamma-secretase/neuregulin 1 signaling. PMID: 24891237
  5. Upregulated PS1/gamma-secretase activity might be a risk factor for late-onset sporadic Alzheimer's disease. PMID: 22140537
  6. Studies demonstrate that gamma-secretase complexes containing different Aph1 subunits exhibit heterogeneous properties; inactivation of Aph1B gamma-secretase in an Alzheimer's disease model improved disease-related characteristics without causing Notch-related side effects. PMID: 19299585
Database Links
Protein Families
APH-1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.