Recombinant Mouse Gamma-secretase subunit PEN-2 (Psenen)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Gamma-Secretase Complex

PEN-2 is indispensable for:

  • Presenilin Endoproteolysis: Triggers cleavage of presenilin into N-terminal (NTF) and C-terminal (CTF) fragments, activating the complex .

  • Complex Stabilization: Binds to presenilin TMD4 to stabilize the active conformation .

  • Substrate Specificity: Modulates cleavage ratios of amyloid-beta peptides (Aβ40 vs. Aβ42) .

Key Findings:

  • Knockout of Psenen in mice results in embryonic lethality due to Notch signaling failure .

  • Mutations in PEN-2’s TMD1 or cytosolic loop disrupt presenilin processing and complex stability .

Production and Biochemical Characteristics

Recombinant Mouse PEN-2 is typically expressed in E. coli or mammalian cells with purification via affinity tags.

ParameterDetail
Expression SystemE. coli (common) or mammalian cells (for post-translational modifications)
Purity≥85% (SDS-PAGE)
TagN-terminal His-tag (e.g., His-PEN-2)
SolubilityRequires detergent solubilization for membrane integration
ActivityFunctional in gamma-secretase reconstitution assays

Therapeutic and Diagnostic Applications

  • In Vitro Reconstitution: Recombinant PEN-2 enables gamma-secretase activity in presenilin-deficient cells .

  • Inhibitor Screening: Used to test gamma-secretase modulators affecting Aβ production .

  • Disease Modeling: Studied in familial acne inversa-2 (ACNINV2) and Alzheimer’s research .

Challenges in Functional Studies

  • Folding and Localization: Proper membrane insertion requires specific detergents or lipid environments .

  • Species-Specific Variations: Mouse PEN-2 may differ in substrate affinity compared to human orthologs .

  • Proteasomal Degradation: Mutant PEN-2 variants (e.g., ΔC-terminus) are prone to degradation without proteasome inhibition .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice shipping, please communicate this need in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Working aliquots can be stored at 4°C for up to one week.
Reconstitution
For optimal results, briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to meet specific tag type requests. Please provide your desired tag type during your order, and we will prioritize its development.
Synonyms
Psenen; Pen2; Gamma-secretase subunit PEN-2; Presenilin enhancer protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLAPAYTEQSQIKGYVWRS AVGFLFWVIILATWITIFQIYRPRWGALGDYLSFTIPLGTP
Uniprot No.

Target Background

Function
PEN-2 (Presenilin Enhancer 2) is an essential subunit of the gamma-secretase complex, an endoprotease complex responsible for the intramembrane cleavage of integral membrane proteins, such as Notch receptors and APP (amyloid-beta precursor protein). The gamma-secretase complex plays a vital role in Notch and Wnt signaling pathways, regulating downstream processes through its involvement in processing key regulatory proteins and modulating cytosolic CTNNB1 levels. PEN-2 modulates both the endoproteolysis of presenilin and the activity of the gamma-secretase complex.
Gene References Into Functions
  1. Using knockout cell lines in combination with siRNA and immunoprecipitation techniques, our research clearly demonstrated that Pen-2 and PS1 are sufficient to form a functionally active gamma-secretase, capable of catalyzing the processing of Notch. This finding strongly suggests that, in addition to presenilin, which acts as the catalytic subunit, Pen-2 is the most crucial component of the gamma-secretase complex. PMID: 28234257
  2. Cleavage of the Interleukin-11 receptor triggers the processing of its C-terminal fragments by the gamma-secretase and the proteasome. PMID: 28735867
  3. The G206D mutation reduced the interaction between presenilin-1 and presenilin enhancer 2, but did not completely abolish gamma-secretase formation and presenilin-1 endoproteolysis PMID: 25394380
  4. Data show that the expression level of presenilin enhancer-2 (Pen-2) is relatively high in the central nervous system during the early stages of postnatal development, but declines gradually in adult mice. PMID: 25736404
  5. Pen-2 may not solely function as a catalyst for gamma-secretase endoproteolysis. It may also stabilize the complex prior to PS1 endoproteolysis, allowing time for complete assembly and proper trafficking. PMID: 24941111

Show More

Hide All

Database Links
Protein Families
PEN-2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of mouse PEN-2 and how does it compare to human PEN-2?

Mouse PEN-2, like its human counterpart, is a 101-amino acid protein that is highly conserved across vertebrates. PEN-2 shows approximately 70% identity (87% similarity) among vertebrates, indicating strong evolutionary conservation of this protein . The protein contains multiple transmembrane domains that are critical for its integration into the gamma-secretase complex. The high conservation suggests that structural and functional characteristics are likely maintained between mouse and human orthologs, making mouse PEN-2 a suitable model for studying gamma-secretase biology relevant to human disease .

What is the functional role of PEN-2 in the gamma-secretase complex?

PEN-2 serves as an essential subunit of the gamma-secretase complex, which is a 19-transmembrane multi-subunit endoprotease complex. Its primary functions include:

  • Facilitating presenilin endoproteolysis, which is crucial for activation of the gamma-secretase complex

  • Modulating gamma-secretase enzymatic activity

  • Contributing to proper complex maturation

  • Enabling the complex to cleave integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein)

Remarkably, PEN-2 alone is both necessary and sufficient to promote endoproteolysis and catalytic activation of presenilin-1 (PS1), as demonstrated in reconstitution studies . This activation is a critical step in gamma-secretase function, as PS1 functions as an inactive zymogen until processed .

How does the knockout of PEN-2 affect cellular and developmental processes?

PEN-2 knockout studies in mice have revealed that the absence of PEN-2 results in embryonic lethality by embryonic day 11 . This phenotype closely resembles those observed in PS1/PS2 double knockout mice and Notch1-deficient mice, underscoring the critical role of PEN-2 in Notch signaling during embryonic development . At the cellular level, PEN-2 deficiency leads to impaired gamma-secretase maturation, prevents presenilin endoproteolysis, and blocks gamma-secretase activity, thereby disrupting the processing of multiple substrate proteins involved in crucial signaling pathways .

What are the optimal methods for expressing and purifying recombinant mouse PEN-2?

The expression and purification of recombinant mouse PEN-2 can be optimized using the following methodology:

  • Expression system selection: Bacterial expression systems (E. coli) can be used effectively when PEN-2 is fused with solubility-enhancing tags like maltose binding protein (MBP) .

  • Construct design: Creating a fusion protein with MBP at the N-terminus of PEN-2, along with a Factor Xa cleavable linker, significantly enhances solubility and facilitates purification .

  • Purification protocol:

    • Affinity chromatography using amylose resin for MBP-tagged proteins

    • Elution with maltose buffer

    • Further purification with size exclusion chromatography if needed

This approach has been shown to yield >95% pure protein at milligram quantities per liter of culture . The MBP tag can either be kept for downstream applications or removed using Factor Xa protease if native PEN-2 is required.

How can researchers verify the functional activity of recombinant PEN-2 in experimental systems?

To verify the functional activity of recombinant PEN-2, researchers can employ several complementary approaches:

  • Cell-based reconstitution assays: Transfecting PEN-2 knockout cell lines (MEFs) with the recombinant PEN-2 construct and assessing:

    • Presenilin-1 endoproteolysis via Western blotting

    • Nicastrin glycosylation status

    • Assembly of the gamma-secretase complex through co-immunoprecipitation studies

  • In vitro reconstitution systems:

    • Incorporating purified recombinant PEN-2 with PS1 into proteoliposomes

    • Measuring PS1 endoproteolysis by Western blotting

    • Assessing gamma-secretase activity using appropriate substrates (APP C99)

  • Functional readouts:

    • Measuring Aβ production (Aβ40 and Aβ42) by ELISA in conditioned media from rescued cells

    • Analyzing AICD (APP intracellular domain) generation by Western blot densitometry

These methods collectively provide a comprehensive assessment of recombinant PEN-2 functionality in both cellular and biochemical contexts.

What tagging strategies are recommended for recombinant PEN-2 in different experimental applications?

The choice of tagging strategy for recombinant PEN-2 depends on the specific experimental application:

Tag TypePositionAdvantagesLimitationsRecommended Applications
MBP TagN-terminus- Enhances solubility
- Facilitates purification
- Maintains functionality
- Allows pull-down of intact complexes
- Large size (43 kDa)
- May slightly alter Aβ generation
- Structural studies
- Protein purification
- Complex isolation
- Functional reconstitution
FLAG TagN-terminus- Small size
- Minimal impact on function
- Good detection in Western blots
- Limited enhancement of solubility- Cell-based studies
- Complex composition analysis
- Trafficking studies
C-terminal TagsC-terminus- Simple detection- Loss of PEN-2 functionNot recommended

Research has demonstrated that while N-terminal tags preserve PEN-2 function, C-terminal tags lead to functional loss . Importantly, the addition of a large N-terminal MBP tag (43 kDa) to PEN-2 surprisingly does not negatively impact gamma-secretase function, making it particularly useful for structural and biochemical studies .

How can recombinant PEN-2 be utilized for structural studies of the gamma-secretase complex?

Recombinant PEN-2 offers several strategic approaches for structural studies of the gamma-secretase complex:

  • Individual subunit structure determination:

    • Purified MBP-PEN-2 can be studied by X-ray crystallography, providing high-resolution structural information about this subunit

    • NMR spectroscopy of isotope-labeled PEN-2 can reveal dynamic aspects of the protein structure

    • 2D-crystallography can provide membrane-embedded structural insights

  • Modular complex reconstruction:

    • Individual structures of gamma-secretase components can be used to build a composite model of the entire complex

    • Cross-linking experiments with purified MBP-PEN-2-containing complexes can identify interaction interfaces

  • Cryo-electron microscopy applications:

    • The MBP tag can serve as a molecular marker to locate PEN-2 within the gamma-secretase complex

    • This approach helps determine PEN-2 orientation and positioning in the assembled complex

  • Structure-function correlations:

    • Site-directed mutagenesis based on structural information can identify critical residues for PEN-2 function

    • These studies can reveal how structural elements of PEN-2 contribute to complex assembly and activity

The high purity and yield of recombinant PEN-2 achieved through MBP-tagging methods make these structural approaches feasible and promising for understanding gamma-secretase architecture .

What are the mechanistic implications of PEN-2's role in presenilin endoproteolysis?

The mechanistic implications of PEN-2's role in presenilin endoproteolysis are profound and multifaceted:

  • Zymogen activation model:

    • Presenilin-1 exists as an inactive zymogen (full-length form)

    • PEN-2 interaction induces conformational changes that facilitate PS1 self-cleavage

    • This process generates the active NTF and CTF fragments required for gamma-secretase activity

  • Autoinhibitory domain regulation:

    • The endoproteolytic cleavage removes an "autoinhibitory" domain within PS1

    • This cleavage may either:
      a) Remove a "plug" that blocks substrate access to the catalytic site
      b) Allow proper positioning of the catalytic aspartyl dyad necessary for proteolysis

  • Minimal activation requirements:

    • Remarkably, PEN-2 alone is sufficient to promote PS1 endoproteolysis in reconstituted proteoliposomes, without requiring other gamma-secretase components

    • This bimolecular interaction between PS1 and PEN-2 is sufficient to induce presenilinase activity

  • Active site probe binding:

    • The photoactivatable probe JC-8 only labels the processed PS1-NTF but not full-length PS1

    • This indicates that endoproteolysis is essential for generating the properly configured active site

These mechanistic insights reveal PEN-2 as a critical activator of gamma-secretase, functioning through direct interaction with PS1 to induce autoproteolysis and conformational maturation of the catalytic site .

How does recombinant PEN-2 contribute to understanding Alzheimer's disease pathogenesis?

Recombinant PEN-2 provides several important contributions to understanding Alzheimer's disease (AD) pathogenesis:

  • Gamma-secretase modulatory mechanisms:

    • Purified PEN-2 in reconstitution studies helps delineate how gamma-secretase activity is regulated

    • This enables better understanding of Aβ generation mechanisms, a central event in AD pathology

  • Structure-based drug design:

    • High-resolution structural information from recombinant PEN-2 studies facilitates rational design of compounds that can modulate gamma-secretase activity

    • This approach may lead to more selective gamma-secretase modulators with fewer off-target effects

  • Disease-associated mutations:

    • Recombinant systems allow assessment of how disease-associated mutations affect PEN-2 function

    • Studies with wild-type and mutant PEN-2 can reveal mechanistic links between genetic variants and altered Aβ production

  • Pathway dissection:

    • MBP-tagged PEN-2 enables isolation of intact gamma-secretase complexes for detailed biochemical analysis

    • This facilitates studies of how other cellular factors interact with the complex to influence AD-related processes

  • Therapeutic target validation:

    • Reconstitution systems using recombinant PEN-2 provide platforms for validating gamma-secretase as a therapeutic target

    • These systems enable testing of how pharmacological agents affect specific aspects of complex assembly and function

The combined insights from these approaches contribute to a more comprehensive understanding of the molecular mechanisms underlying AD and may guide the development of targeted therapeutic strategies .

What factors affect the stability and solubility of recombinant PEN-2, and how can these issues be addressed?

Several factors affect the stability and solubility of recombinant PEN-2, with corresponding solutions:

  • Membrane protein nature:

    • PEN-2 is a transmembrane protein with multiple hydrophobic domains

    • Solution: Fusion with MBP tag significantly enhances solubility in aqueous solutions

    • Alternative: Appropriate detergent selection for membrane protein extraction and purification

  • Expression system limitations:

    • Bacterial expression systems may limit proper folding

    • Solution: Optimization of induction conditions (temperature, IPTG concentration)

    • Alternative: Expression in wheat germ cell-free systems for eukaryotic protein production

  • Aggregation propensity:

    • Recombinant PEN-2 may form aggregates during purification

    • Solution: Addition of glycerol (5-10%) to buffers to reduce aggregation

    • Solution: Purification under denaturing conditions followed by controlled refolding

  • Proteolytic degradation:

    • PEN-2 may be subject to proteolysis

    • Solution: Addition of protease inhibitors during purification

    • Solution: Maintaining samples at cold temperatures throughout handling

  • Storage considerations:

    • Protein stability may decrease during storage

    • Solution: Storage in small aliquots at -80°C

    • Solution: Addition of stabilizing agents such as glycerol or sucrose

These challenges can be effectively managed through careful optimization of expression constructs, purification protocols, and buffer compositions to maintain PEN-2 in its native conformation .

How do researchers address data inconsistencies when comparing recombinant PEN-2 activity in different experimental systems?

When facing data inconsistencies across different experimental systems, researchers can implement the following strategies:

  • Standardization of protein preparations:

    • Use consistent purification protocols and quality control measures

    • Confirm protein purity by SDS-PAGE (>95% purity recommended)

    • Verify protein folding through circular dichroism or other biophysical techniques

  • Contextual differences assessment:

    • Systematically compare in vitro reconstitution systems versus cellular assays

    • Document differences in lipid compositions of proteoliposomes that may affect activity

    • Consider the influence of other cellular factors present in cell-based systems but absent in purified preparations

  • Validation across multiple readouts:

    • Use complementary assays to measure activity:

      • PS1 endoproteolysis via Western blotting

      • Substrate processing (APP C99 to AICD and Aβ)

      • Direct binding assays (e.g., with photoaffinity probes like JC-8)

  • Normalization strategies:

    • Normalize activity measurements to the amount of mature complex formed

    • Express results relative to appropriate controls (e.g., F-PEN-2 as a reference point)

    • Account for differences in expression levels when comparing constructs

  • Critical evaluation of parameters affecting activity:

    • Temperature and pH dependencies that may vary between systems

    • Detergent or lipid environment effects on protein conformation and activity

    • Influence of different tags or fusion partners on protein behavior

By implementing these approaches, researchers can better reconcile inconsistencies and develop a more coherent understanding of PEN-2 function across experimental platforms.

What are the current limitations in using recombinant PEN-2 for high-resolution structural studies?

Despite significant advances, several limitations persist in using recombinant PEN-2 for high-resolution structural studies:

  • Membrane protein crystallization challenges:

    • PEN-2's multiple transmembrane domains complicate crystallization

    • The small size (101 amino acids) provides limited surface area for crystal contacts

    • Solution: Use of fusion partners like MBP not only for solubility but also to provide additional crystal contact surfaces

  • Conformational heterogeneity:

    • PEN-2 may adopt multiple conformations, particularly when isolated from the gamma-secretase complex

    • The flexibility may impede crystal formation or result in lower resolution structures

    • Solution: Stabilization through appropriate detergents, lipids, or binding partners

  • Context-dependent structure:

    • PEN-2's native conformation may depend on interactions with other gamma-secretase components

    • Isolated PEN-2 may not faithfully represent its structure within the assembled complex

    • Solution: Co-crystallization with interacting partners or domains from other subunits

  • Technical limitations:

    • NMR studies are challenging due to the need for isotope labeling and size limitations

    • Cryo-EM resolution may be limited by the small size of PEN-2 alone

    • Solution: Innovative tagging strategies to increase visibility in cryo-EM studies

  • Functional validation of structures:

    • Ensuring that structural information relates to the functional state

    • Challenge in distinguishing between native conformations and artifacts

    • Solution: Correlation of structural data with functional assays in reconstituted systems

Addressing these limitations requires multidisciplinary approaches combining advances in membrane protein structural biology with functional validation in reconstituted systems .

What emerging techniques might advance our understanding of PEN-2's role in gamma-secretase function?

Several emerging techniques show promise for advancing our understanding of PEN-2's role in gamma-secretase function:

  • Cryo-electron tomography:

    • Enables visualization of gamma-secretase complexes in their native membrane environment

    • Could reveal how PEN-2 positioning affects complex assembly and substrate recruitment

    • May capture different conformational states during the catalytic cycle

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Can map dynamic regions and conformational changes in PEN-2 upon complex assembly

    • Identifies protected regions that form interaction interfaces with other subunits

    • Monitors structural changes during substrate binding and processing

  • Single-molecule FRET studies:

    • Reports on distances between labeled residues in PEN-2 and other subunits

    • Captures conformational dynamics during complex assembly and function

    • Reveals population heterogeneity that may be masked in ensemble measurements

  • AlphaFold and integrative modeling approaches:

    • AI-based structure prediction combined with sparse experimental data

    • Generation of testable structural models for PEN-2 within the complex

    • Integration of crosslinking data, cryo-EM, and biochemical constraints

  • Proximity labeling techniques (BioID, APEX):

    • Identification of transient PEN-2 interaction partners in cellular contexts

    • Mapping of the PEN-2 interaction network during different cellular states

    • Elucidation of how PEN-2 influences gamma-secretase localization and trafficking

These emerging techniques, especially when combined, have the potential to provide unprecedented insights into PEN-2's structural organization, dynamics, and functional interactions within the gamma-secretase complex.

How might therapeutic strategies targeting PEN-2 be developed for Alzheimer's disease?

Therapeutic strategies targeting PEN-2 for Alzheimer's disease could be developed through several approaches:

  • Structure-based inhibitor design:

    • Utilizing high-resolution structural information from recombinant PEN-2 studies to design molecules that modulate its interaction with PS1

    • Targeting the PEN-2/PS1 interface to selectively alter gamma-secretase activity without completely inhibiting it

    • Developing compounds that modify PEN-2-mediated conformational changes to shift the Aβ42/40 ratio toward less amyloidogenic forms

  • Allosteric modulation:

    • Identification of allosteric sites on PEN-2 that can influence gamma-secretase activity

    • Design of small molecules that bind these sites to subtly alter complex dynamics

    • This approach may offer greater selectivity than targeting the catalytic site directly

  • Selective substrate processing modification:

    • Exploiting the observation that MBP-tagged PEN-2 alters Aβ production patterns

    • Developing strategies that mimic this effect to reduce pathogenic Aβ species while preserving processing of other substrates

    • This could potentially reduce side effects associated with complete gamma-secretase inhibition

  • Gene therapy approaches:

    • Development of modified PEN-2 variants that incorporate favorable properties

    • Delivery of engineered PEN-2 genes to gradually replace endogenous protein

    • This could potentially shift gamma-secretase activity toward less pathogenic processing patterns

  • Combination therapies:

    • Pairing PEN-2-targeted approaches with interventions targeting other aspects of AD pathology

    • Synergistic effects may be achieved by simultaneously modulating multiple pathways

    • This multi-target approach may be more effective for a complex disease like AD

The development of PEN-2-targeted therapeutics would benefit from the reconstitution systems described in the research, which provide platforms for screening and validating candidate compounds .

What role might post-translational modifications of PEN-2 play in regulating gamma-secretase activity?

Post-translational modifications (PTMs) of PEN-2 likely play significant regulatory roles in gamma-secretase activity, though this area remains relatively unexplored:

  • Potential PTM sites and types:

    • Phosphorylation of serine/threonine residues could modify PEN-2 conformation

    • Ubiquitination might regulate PEN-2 stability and turnover

    • Palmitoylation could affect membrane localization and protein-protein interactions

    • Glycosylation might influence trafficking and complex assembly

  • Functional implications:

    • PTMs may serve as molecular switches that regulate PEN-2's ability to activate PS1

    • Modifications could alter the stability of PEN-2's interaction with other complex components

    • Different PTM patterns might direct gamma-secretase to specific cellular compartments

    • These modifications could influence substrate selectivity or cleavage site preference

  • Methodological approaches to study PEN-2 PTMs:

    • Mass spectrometry-based proteomics to identify and quantify PEN-2 modifications

    • Site-directed mutagenesis of potential modification sites in recombinant PEN-2

    • Reconstitution studies comparing differentially modified PEN-2 proteins

    • Development of modification-specific antibodies for tracking PTM status

  • Potential relevance to disease:

    • Altered PTM patterns might contribute to pathological changes in gamma-secretase activity

    • Age-related changes in PEN-2 modifications could influence Aβ generation

    • PTMs could represent targetable regulatory mechanisms for therapeutic intervention

Future research using recombinant PEN-2 systems could systematically investigate how specific modifications affect its function in gamma-secretase activation and activity regulation, potentially revealing new therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.