Recombinant Mouse Ganglioside-induced differentiation-associated protein 1 (Gdap1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
Gdap1; Ganglioside-induced differentiation-associated protein 1; GDAP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Gdap1
Target Protein Sequence
MARRQDEARAGVPLRVEGPPDKEVHLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPL SEHNEPWFMRLNSAGEVPVLVHGENIICEATQIIDYLEQTFLDERTPRLMPDEGSMYYPR VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPD LQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGNQPWLC GESFTLADVSLAVTLHRLKFLGFARRNWGHGKRPNLETYYERVLKRKTFNKVLGHVNNIL ISAVLPTAFRVAKKRAPKVLGSTLVVGLLVGMGYFAFMLFRRRLGSMILALRPRPNYF
Uniprot No.

Target Background

Function
Recombinant Mouse Ganglioside-induced differentiation-associated protein 1 (GDAP1) regulates the mitochondrial network by promoting mitochondrial fission.
Gene References Into Functions
  1. GDAP1 deficiency induces peripheral neuropathy with motor neuron loss, mitochondrial dysfunction, and abnormal calcium homeostasis. PMID: 25860513
  2. GDAP1 family members exhibit protective effects against stress associated with elevated oxidized glutathione levels. PMID: 24480485
  3. GDAP1 expression in the nervous system and its role in Charcot-Marie-Tooth disease type 4A pathogenesis have been reported. PMID: 18021315
Database Links
Protein Families
GST superfamily
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein. Cytoplasm.
Tissue Specificity
Expressed in brain, spinal cord, muscles and intestinal villi. In the central nervous system expressed most prominently in the cortex, cerebellum, thalamus, olfactory bulb, and spinal cord. Expressed also in sciatic nerves and in dorsal root ganglia.

Q&A

What is the basic structure of GDAP1 and where is it localized?

GDAP1 is an integral, tail-anchored protein primarily located in the mitochondrial outer membrane and peroxisomal membrane. Structurally, it contains domains characteristic of glutathione S-transferases (GSTs), including GST-N and GST-C domains, but with distinctive features that establish it as the founder of a new GST family . These unique features include an enlarged interdomain between GST-N and GST-C domains and C-terminal hydrophobic stretches with potential transmembrane characteristics . Crystal structure analysis shows that the GDAP1 core domain shares a fold similar to canonical GST enzymes despite only ~20% sequence identity, with significant structural differences including a missing α-helix between β2 and β3 and unique helices α5 and α6 with a connecting α5-α6 loop .

What is the cellular expression pattern of GDAP1?

GDAP1 is expressed in both neurons and Schwann cells of myelinated peripheral nerves, suggesting that both cell types may contribute to the mixed features of GDAP1-associated diseases . This dual expression pattern is particularly significant as it helps explain the heterogeneous phenotypes observed in Charcot-Marie-Tooth disease (CMT) caused by GDAP1 mutations, which can include both pronounced axonal damage and demyelination characteristics . The expression in both neural cell types indicates that therapeutic approaches may need to target multiple cell populations.

What are the recommended methods for producing recombinant GDAP1 for structural studies?

For structural studies of recombinant GDAP1, researchers have successfully employed C-terminally truncated constructs including GDAP1∆295-358, GDAP1∆303-358, and GDAP1∆319-358 . These constructs retain the GDAP1-specific insertion (α-loop) while eliminating the transmembrane regions that would make the protein insoluble. The methodology involves:

  • Generation of synthetic codon-optimized genes for bacterial cytosolic expression

  • PCR amplification of truncated constructs

  • Transfer into appropriate expression vectors (e.g., pDONR221 entry vector using Gateway cloning)

  • Expression in bacterial systems

  • Purification using standard chromatography techniques

For crystallization, proteins should be dialyzed against appropriate buffers (e.g., 25 mM HEPES pH 7.5, 300 mM NaCl) and centrifuged at high speed (>20,000 g) to remove aggregates before setting up crystallization trials .

How can I analyze the oligomeric state of GDAP1 in experimental settings?

GDAP1 exists in a dynamic equilibrium between monomeric and dimeric forms, with the equilibrium being concentration-dependent and influenced by redox conditions . To analyze the oligomeric state:

  • Size Exclusion Chromatography (SEC): Use varying protein concentrations to observe the dimer/monomer equilibrium. At lower concentrations, SEC typically shows two distinct peaks corresponding to dimers and monomers, while higher concentrations yield broader peaks .

  • Reducing vs. Non-reducing Conditions: Under non-reducing conditions, GDAP1 adopts both dimeric and monomeric forms, whereas under reducing conditions (with DTT), dimers disappear, indicating the involvement of inter-subunit disulfide bonds in dimerization .

  • SEC-SAXS (Small-Angle X-ray Scattering): This technique allows separation and analysis of monomeric and dimeric species, enabling determination of their structural parameters including radius of gyration (Rg) and maximum particle dimension (Dmax) .

Oligomeric StateDetection MethodKey Indicators
MonomerSEC, SEC-SAXSSingle peak at appropriate molecular weight
DimerSEC, SEC-SAXS under non-reducing conditionsPeak at approximately twice the monomer molecular weight
Dynamic EquilibriumSEC at varying concentrationsBroad peaks or concentration-dependent peak ratios

What techniques are available for studying GDAP1-ligand interactions?

Several complementary techniques have been employed to identify and characterize GDAP1-ligand interactions:

How do mutations in GDAP1 contribute to Charcot-Marie-Tooth disease pathology?

Mutations in GDAP1 lead to severe forms of Charcot-Marie-Tooth disease (CMT), a peripheral motor and sensory neuropathy characterized by heterogeneous phenotypes . The pathological mechanisms vary based on the inheritance pattern:

  • Recessively Inherited Mutations: These mutant forms exhibit reduced fission-promoting activity, impairing normal mitochondrial dynamics . Truncation mutations found in CMT patients fail to target to mitochondria and have completely lost mitochondrial fragmentation activity .

  • Dominantly Inherited Mutations: These mutant forms interfere with mitochondrial fusion processes, creating a different disruption to mitochondrial dynamics .

  • Point Mutations: Disease-associated GDAP1 point mutations show strongly reduced fragmentation activity, indicating impaired function rather than mislocalization .

The dual expression of GDAP1 in both neurons and Schwann cells explains the mixed features of the disease, including pronounced axonal damage and demyelination . Additionally, while normal GDAP1 expression is protective in glutamate-induced toxicity, this protection is reduced in recessive mutants, suggesting a role in neuroprotection .

What are the most common disease-associated mutations in GDAP1 and how do they affect protein function?

Several clinically significant mutations have been identified in GDAP1:

MutationInheritance PatternFunctional EffectPopulation Prevalence
R120WDominantImpaired functionMost common genotype in Spanish patients
H123RDominantImpaired functionReported in European patients
A156GDominantImpaired functionReported in European patients
P274LDominantImpaired functionReported in European patients

These mutations affect protein function in various ways:

  • Some mutations cause mislocalization of GDAP1, preventing it from reaching the mitochondrial membrane

  • Others result in properly localized but functionally compromised protein

  • Truncating mutations that affect the C-terminal domain prevent proper membrane targeting and abolish fragmentation activity

The location of disease-associated mutations relative to functional domains provides insights into structure-function relationships. For instance, the HA binding site in GDAP1 crystal structure is located close to a CMT-linked residue cluster and the membrane-binding surface, suggesting potential mechanistic connections between ligand binding, membrane association, and disease pathology .

How does the unique dimerization mechanism of GDAP1 affect its function compared to canonical GSTs?

GDAP1 exhibits a dimerization mechanism distinct from canonical GST enzymes, which impacts its functional properties . Key differences include:

  • Unique Dimer Interface: GDAP1 forms homodimers mediated by a hydrophobic surface and a disulfide bridge, unlike the typical GST dimer interface . This distinct arrangement prevents formation of canonical GST dimers.

  • Redox Sensitivity: The GDAP1 dimer is stabilized by inter-subunit disulfide bonds that dissociate under reducing conditions, suggesting potential redox regulation of its oligomeric state and function .

  • Functional Implications: While dimerization is critical for canonical GST activity in all known GST classes, GDAP1's unique dimerization mechanism correlates with its divergent functional properties . Despite structural similarities, GDAP1 lacks canonical GST activity, suggesting evolutionary repurposing of the GST fold for mitochondrial dynamics regulation.

  • Molecular Switch Hypothesis: The distinct dimerization, combined with evidence that GDAP1's hydrophobic domain 1 (HD1) regulates both GST activity and membrane fission capacity, suggests a molecular switch mechanism where GDAP1 transitions between active and auto-inhibited conformations .

This unique structure-function relationship makes GDAP1 an intriguing model for studying how protein domains can be evolutionarily repurposed for novel cellular functions.

What is the relationship between GDAP1 ligand binding, structural changes, and functional regulation?

Research has identified hydroxamic acid (HA) as a ligand for GDAP1, with binding inducing significant effects on protein properties :

  • Structural Compaction: SEC-SAXS analysis shows that HA binding leads to a more compact GDAP1 structure for both monomeric and dimeric forms, as indicated by reduced radius of gyration (Rg) and altered distance distribution patterns .

  • Stability Enhancement: Thermal unfolding studies demonstrate that HA binding increases GDAP1 thermal stability, with temperature shift (Tm) increases proportional to HA concentration .

  • Oligomerization Effects: The HA-GDAP1 complex shows a higher monomer fraction compared to apo GDAP1, with better separation between monomeric and dimeric peaks in size-exclusion chromatography .

  • Functional Implications: The HA binding site is located close to both a CMT-linked residue cluster and the membrane-binding surface, suggesting potential allosteric regulation of membrane interaction and GDAP1 function .

These findings point to a model where ligand binding induces conformational changes that affect GDAP1's oligomeric state, structural flexibility, and potentially its membrane remodeling activity. This represents an advanced area for research into the allosteric regulation of GDAP1 and potential therapeutic targeting.

How do GDAP1 and its homolog GDAP1L1 differ in structure and function?

GDAP1 and its homolog GDAP1L1 exhibit significant differences in their structural and functional properties:

  • Oligomerization Behavior: While GDAP1 exists in a dimer-monomer equilibrium, GDAP1L1 appears to be quantitatively monomeric based on SEC-SAXS analysis, with a calculated molecular mass of approximately 44 kDa .

  • Structural Flexibility: GDAP1L1 shows increased structural flexibility compared to the GDAP1 core domain, as indicated by its dimensionless Kratky plot displaying an asymmetric bell-shaped curve . It has a longer maximum particle dimension (Dmax) of 100 Å, with a P(r) function showing a long tail that implies disordered regions corresponding to the N-terminus and C-terminal hydrophobic domain (HD) and transmembrane domain (TMD) .

  • Solubility Characteristics: Unlike GDAP1, the single transmembrane domain of recombinant GDAP1L1 does not render it insoluble, which could be related to the different oligomeric states .

These differences suggest that despite sequence homology, GDAP1 and GDAP1L1 may have evolved distinct functions or regulatory mechanisms. The functional significance of these structural differences represents an important area for future investigation, particularly in understanding tissue-specific roles and potential complementary or compensatory functions in disease states.

What are promising strategies for developing therapeutic approaches targeting GDAP1?

Based on current understanding of GDAP1 structure and function, several therapeutic strategies warrant investigation:

  • Small Molecule Modulators: The identification of hydroxamic acid (HA) as a GDAP1 ligand that affects protein stability, conformation, and oligomerization opens possibilities for developing small molecule therapeutics . Compounds targeting the HA binding site could potentially modulate GDAP1 function in disease states.

  • Structure-Based Drug Design: The crystal structure of GDAP1 provides a foundation for rational drug design targeting specific functional domains or interfaces . Particular focus could be on compounds that:

    • Stabilize functional conformations of disease-associated mutants

    • Promote proper mitochondrial targeting of truncated variants

    • Modulate oligomerization to maintain functional dimers

  • Allosteric Regulators: Evidence suggests GDAP1 undergoes conformational switching between active and auto-inhibited states . Molecules that allosterically shift this equilibrium could restore function to partially compromised mutants.

  • Cell-Type Specific Approaches: Given GDAP1's expression in both neurons and Schwann cells, therapeutics might need to target multiple cell types . Delivery systems with tropism for specific neural cell populations could enhance efficacy.

What experimental systems are most appropriate for studying GDAP1 function in vivo?

Optimal experimental systems for investigating GDAP1 function in vivo should recapitulate key aspects of its biology:

  • Mammalian Cell Lines: COS-7 cells have been successfully used to study GDAP1-induced changes in mitochondrial morphology over time . These provide accessible systems for initial characterization of wild-type and mutant GDAP1 functions.

  • Primary Neural Cultures: Given GDAP1's expression in neurons and Schwann cells, primary cultures of these cell types provide more physiologically relevant contexts for studying function and disease mechanisms .

  • Co-culture Systems: Since GDAP1 mutations affect both neuronal and glial cells, co-culture systems of neurons and Schwann cells would allow investigation of cell-autonomous and non-cell-autonomous effects.

  • Animal Models: Mouse models with GDAP1 mutations corresponding to human disease variants would facilitate in vivo studies of pathophysiology and preclinical therapeutic testing.

  • Patient-Derived iPSCs: Induced pluripotent stem cells from CMT patients with GDAP1 mutations, differentiated into relevant neural cell types, offer opportunities to study disease mechanisms in human genetic backgrounds.

When selecting experimental systems, researchers should consider factors including endogenous GDAP1 expression levels, mitochondrial network characteristics, and the ability to perform relevant functional assays such as mitochondrial dynamics assessment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.