Recombinant Mouse Gap junction alpha-1 protein (Gja1)

Shipped with Ice Packs
In Stock

Description

Biological Function

Gja1 forms hexameric connexon channels that dock between adjacent cells to create gap junctions. Key functional insights include:

  • Subcellular Localization: Predominantly localizes to cell membranes, gap junctions, and pericentriolar regions .

  • Interactions: Binds Rab11 and Rab8 GTPases to regulate ciliary trafficking , interacts with TJP1 (zonula occludens-1) for blood-testis barrier integrity , and associates with mTOR to modulate phosphorylation dynamics .

  • Roles in Disease: Dysregulation links to cardiac arrhythmias, spermatogenesis defects, and ciliopathies .

3.1. In Vitro Studies

Recombinant Gja1 is used to investigate:

  • Ciliogenesis: Depletion disrupts primary cilium formation in retinal pigment epithelium (RPE1) cells by mislocalizing Rab11 vesicles .

  • Spermatogenesis: mTOR-mediated phosphorylation (Ser373) regulates Gja1 internalization in Sertoli cells, affecting germ cell progression .

3.2. Detection Tools

The Mouse Gja1 ELISA Kit (Assay Genie) provides quantitative analysis with:

ParameterSpecification
Detection Range78–5,000 pg/mL
Sensitivity39 pg/mL
Sample TypesSerum, plasma, cell lysates
SpecificityNo cross-reactivity with other connexins

4.1. Regulation by mTOR-AKT Signaling

  • In Mtor knockout mice, Gja1 phosphorylation at Ser373 increased, leading to its internalization and disrupted spermatogenesis .

  • AKT activation directly phosphorylates Gja1, altering gap junction dynamics .

4.2. Role in Ciliary Trafficking

  • Gja1 depletion in Xenopus and human RPE1 cells caused:

    • Loss of Rab11 vesicle accumulation at ciliary bases .

    • Reduced acetylated microtubules in pericentriolar regions .

  • Co-immunoprecipitation confirmed Gja1-Rab11 interactions critical for ciliogenesis .

Production and Quality Control

Recombinant Gja1 is produced under stringent conditions:

ParameterSpecification
Purity>85–90% (SDS-PAGE)
StorageLyophilized or liquid form at -20°C/-80°C
Endotoxin LevelsNot detected

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Gja1; Cxn-43; Gap junction alpha-1 protein; Connexin-43; Cx43; Gap junction 43 kDa heart protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI
Uniprot No.

Target Background

Function

Connexin 43 (Cx43) is a gap junction protein that regulates bladder capacity. Gap junctions facilitate the intercellular diffusion of low-molecular-weight compounds via connexons. Cx43 negatively regulates bladder functional capacity by enhancing intercellular electrical and chemical transmission, thereby increasing the sensitivity of bladder muscles to cholinergic stimuli and promoting contraction. Cx43 may also play a role in cell growth inhibition via NOV expression and localization regulation. It is essential for gap junction communication in the ventricles and is possibly the ATP-induced pore in mouse macrophages.

Gene References Into Functions
  1. CLMP deficiency severely reduces Connexin43 and Connexin45 protein levels in intestinal and ureter smooth muscle cells, despite minimal effect on mRNA levels. PMID: 29361518
  2. Cx43 gap junctions inhibit IL-10/cisplatin-induced cell invasion and migration. PMID: 29571253
  3. Astroglial Cx43 deletion in APP/PS1 mice improves cognitive function by reducing astrogliosis and enhancing synaptic function, without affecting amyloid plaque formation or inflammation. PMID: 30031059
  4. Cx43 phosphorylation in astrocytes is linked to astrocytic coupling, apoptosis, and vascular regeneration in retinal ischemia, suggesting it as a therapeutic target for proliferative retinopathies. PMID: 29891713
  5. Cx43 is crucial for adult neurogenesis, as its deficiency disrupts coupling between radial glia-like cells and astrocytes, reducing proliferation and neurogenesis in the dentate gyrus. PMID: 28689039
  6. Coxsackievirus B3 infection reduces Cx43 expression by increasing miR-1 levels in mouse viral myocarditis. PMID: 30097120
  7. Yimu San (YMS), a Chinese veterinary medicine, increases oxytocin, PGE2, and Cx43 in pregnant mice uterine smooth muscle. PMID: 29119736
  8. Cx43's response to H2O2 stress depends on AMPK signaling, regulating ROS production and cell necrosis. PMID: 29279848
  9. Cx43 shRNA injection reduces heterotopic ossification (HO) volume after tenotomy injury. PMID: 27849058
  10. Salmonella enterica serovar choleraesuis and resveratrol reduce IDO1 production by upregulating Cx43 in murine melanoma cells. PMID: 29104473
  11. Akt1(-/-)/iAkt2 KO hearts show decreased Cx43 and ZO-1 expression, further decreased by Akt1/2 silencing. PMID: 29378301
  12. Th1 cell-derived IFNγ activates microglia, releasing IL-1β, which reduces Cx43 gap junctions in astrocytes, disrupting astrocytic communication and potentially exacerbating multiple sclerosis. PMID: 27929069
  13. Gap junctions exist between tanycytes and between tanycytes and hypophysiotropic neuron axons. Cx43 hemichannels may facilitate transport between tanycytes and cerebrospinal fluid, extracellular space, and bloodstream. PMID: 28803831
  14. Metastatic NIH3T3x8x3 cells show reduced Cx43 expression/mitochondrial translocation compared to parental and reverting cells. PMID: 29154903
  15. α-connexin Carboxyl Terminal (αCT1) peptide reduces NSPC proliferation and increases caspase 3/7 expression by reducing Cx43 and p-Serine368 expression. PMID: 28648814
  16. Gja1 gene expression is upregulated in ethanol drinkers compared to controls. PMID: 28714806
  17. Cerebral cortex Bergmann glial processes show a mosaic of Cx43/Cx45-puncta, suggesting differential coupling regulation via gap junctions with varying permeability. PMID: 28561933
  18. Non-myocytes in cardiac scar are electrically coupled to myocytes, dependent on Cx43 expression. PMID: 27244564
  19. MIF contributes to atrial fibrillation pathogenesis by downregulating Cx43 expression via ERK1/2 kinase activation. PMID: 28429502
  20. ELF-EMFs accelerate myogenesis by increasing MyoD, myogenin, and Cx43 expression. PMID: 28607928
  21. Cx43 C-terminal domain proteolytic cleavage under pathological conditions may contribute to its deleterious effects in osteoarthritis. PMID: 27682878
  22. Neonatal hypothyroidism impairs testicular glucose homeostasis and reduces Cx43 expression, affecting germ cell survival and proliferation. PMID: 28471544
  23. No cortical bone abnormalities in single Gja1+/- or Sost+/- mice, despite increased thickness in Sost-/- mice. PMID: 29149200
  24. The C-terminal domain of Cx43 in osteocytes maintains bone structure and mechanical integrity. PMID: 27113527
  25. Astroglial Cx43 knockout in APPswe/PS1dE9 mice reduces neuronal damage by diminishing gliotransmitter release and alleviating oxidative stress and neuritic dystrophies. PMID: 27391799
  26. Cx43 inhibits c-Src activity, hindering Nrf2 nuclear export and reducing FN, ICAM-1, and TGF-β1 expression, attenuating renal fibrosis in diabetes. PMID: 27840317
  27. Dexamethasone induces Cx43 internalization into autophagosomes/autolysosomes and degradation via autophagy. PMID: 27127181
  28. Disruption of the Cx43/miR21 pathway leads to osteocyte apoptosis and increased osteoclastogenesis with aging. PMID: 28317237
  29. Dilated cardiomyopathy hearts show decreased Cx43 expression following increased CELF1 expression. PMID: 28874395
  30. Increased Cx43 expression promotes renal inflammation and glomerular damage. PMID: 28667079
  31. Simulated weightlessness promotes Cx43 retention in the Golgi apparatus. PMID: 26945892
  32. Astrocytic Cx43 knockout causes excessive sleepiness and fragmented wakefulness. PMID: 28867552
  33. Astrocytic hemichannel activity depends on intracellular calcium and is associated with D-serine release, impacting LTP. PMID: 28821660
  34. Enteric glia activation via Cx43 and P2X receptors modulates morphine-related inflammation and constipation. PMID: 28280004
  35. Reduced Cx43 expression in vascular cells impairs vasomotor control in experimental diabetes. PMID: 28674171
  36. Blocking connexin32 or Cx43 hemichannels reduces pro-inflammatory cytokines and acetaminophen-induced liver injury. PMID: 28687253
  37. Astrocytic Cx43 knockout inhibits OPC proliferation by decreasing matrix glucose levels, also observed in acute brain slices. PMID: 27006115
  38. Male Gja1(-/K258Stop) mice show a cortical bone phenotype similar to those with complete Cx43 gene deletion in osteoblasts. PMID: 28049723
  39. Cx43 residue S368 is phosphorylated on gap junctions and connexosomes, while S262 is phosphorylated only on some connexosomes. PMID: 28202692
  40. Myosin VI loss affects Cx43 homeostasis, resulting in a plaque accretion defect. PMID: 28096472
  41. Spinal cord injury activates astrocyte sigma-1 receptors, increasing Cx43 expression and astrocyte activation, contributing to mechanical allodynia. PMID: 27567941
  42. Beige adipocytes exhibit increased cell-to-cell coupling via Cx43 gap junction channels. PMID: 27626200
  43. Cx43 in lymphatic endothelial cells is essential for lymphatic valve development. PMID: 27899284
  44. Gja1 may mediate Acvr1 effects on uterine stromal cell differentiation via cAMP-PKA signaling and Hand2 targeting. PMID: 28219934
  45. Pre- and peri-implantation development does not require Cx43 and Cx45. PMID: 27172058
  46. No significant difference in Cx43 expression between fetal day 13 mice and adults. PMID: 28296544
  47. Cx43 facilitates cAMP communication between cells, impacting signal transduction and bone effector molecule expression. PMID: 27156839
  48. AIF-Cx43, ETFB-Cx43, and AIF-ETFB interactions may regulate mitochondrial redox state. PMID: 26915330
  49. Heterogeneous Cx43 expression influences ephaptic coupling, preventing or promoting conduction block depending on Cx43 knockout content. PMID: 26968493
  50. Insulin's cardioprotection against cryoinjury in diabetic mice involves Cx43 gap junction function and phosphorylation. PMID: 27034963
Database Links
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Endoplasmic reticulum.
Tissue Specificity
Expressed in heart, non-sensory epithelial cells, and in fibrocytes of the spiral ligament and the spiral limbus. Expressed in bladder smooth muscle cells (at protein level). Expressed in astrocytes (at protein level).

Q&A

What is the optimal storage condition for recombinant mouse GJA1 protein to maintain stability?

Recombinant mouse GJA1 protein exhibits optimal stability when stored at 2-8°C and remains stable for at least 6 months from receipt date under proper storage conditions. For liquid formulations, the protein is typically supplied in Tris/PBS-based buffer with 5-50% glycerol. If supplied as lyophilized powder, the pre-lyophilization buffer typically contains Tris/PBS with 6% Trehalose at pH 8.0. It is critically important to avoid repeated freeze-thaw cycles which can significantly compromise protein integrity and function .

What expression systems are most effective for producing functional recombinant mouse GJA1?

The baculovirus expression system has demonstrated high efficiency for recombinant mouse GJA1 production, particularly for proteins with complex transmembrane domains like Cx43. This system facilitates proper protein folding and post-translational modifications essential for functional activity. HEK293 mammalian expression systems are also frequently utilized, especially when studying mouse GJA1 in contexts requiring mammalian glycosylation patterns . When selecting an expression system, researchers should consider:

  • Required protein yield

  • Post-translational modification requirements

  • Downstream application compatibility

  • Potential endotoxin concerns for in vivo applications

How can researchers confirm the functionality of recombinant mouse GJA1 protein in experimental settings?

Functional verification of recombinant mouse GJA1 requires multiple complementary approaches:

  • Gap junction communication assays: Dye transfer experiments using Lucifer Yellow or calcein to assess intercellular communication capacity

  • Electrophysiological measurements: Patch-clamp techniques to evaluate channel conductance

  • Protein-protein interaction studies: Co-immunoprecipitation with known binding partners such as Rab11a

  • Subcellular localization analysis: Immunofluorescence to confirm appropriate trafficking to plasma membrane and formation of typical gap junction plaques

What strategies are effective for studying the role of specific GJA1 domains in cellular function?

Advanced domain analysis requires sophisticated approaches:

  • Dominant-negative mutants: Generate specific mutations like T154A (which mimics closed-channel status without inhibiting gap junction formation) or Δ130-136 (which blocks gap junction permeability)

  • CRISPR/Cas9-mediated F0 mutagenesis: Target specific domains while measuring functional outcomes

  • Domain-specific antibodies: Use antibodies targeting specific regions (N-terminal, C-terminal, or extracellular loops)

  • Truncation constructs: Express partial proteins (such as aa 232-382) to isolate domain-specific functions

For the C-terminal tail specifically, the Δ234-243 mutant can be utilized to study the 10-amino acid deletion in the putative tubulin-binding sequence, which exists only in GJA1 and not in other gap junction protein families .

How can researchers effectively investigate GJA1-protein interactions beyond traditional gap junction functions?

Recent research has uncovered non-canonical roles for GJA1 beyond gap junction formation. To investigate these functions:

  • Proximity ligation assays: Identify interactions with novel protein partners in their native cellular context

  • Mass spectrometry following immunoprecipitation: GJA1 antibody-conjugated paramagnetic beads can be used to identify interaction partners; studies have identified associations with Rab8a and Rab11a

  • Structured illumination microscopy (SIM): Provides high-resolution visualization of protein complexes, revealing how GJA1 co-localizes with partners like Rab11-positive vesicles

  • Co-immunoprecipitation: Confirm specific interactions using antibodies against potential partners

Research has revealed unexpected roles for GJA1 in ciliogenesis through interactions with the actin cytoskeleton and Rab proteins, highlighting the importance of investigating non-canonical functions .

What methodological approaches best characterize the trafficking and localization of GJA1 in cellular models?

Advanced trafficking studies require multi-parameter analysis:

  • Live-cell imaging with fluorescently tagged GJA1: Monitor real-time delivery to intercalated discs or cell-cell borders

  • Microtubule co-tracking experiments: Evaluate microtubule-dependent trafficking of GJA1 using co-immunostaining with α-tubulin or EB1

  • Inhibitor studies: Use compounds like latrunculin A (LatA) at 250 nM to disrupt actin polymerization, revealing actin-dependent GJA1 trafficking mechanisms

  • Quantification approaches: Analyze the number of EB1 comets or α-tubulin molecules reaching cell-cell borders, normalized to border length

Research has demonstrated that GJA1-20k isoform stabilizes actin filaments which guides growth trajectories of the Cx43 microtubule trafficking machinery, highlighting the complex interplay between cytoskeletal elements in GJA1 trafficking .

What are the optimal approaches for studying GJA1 isoforms and their differential functions?

GJA1 produces multiple protein isoforms through internal translation mechanisms that require specialized study methods:

  • Isoform-specific expression constructs: Mutate internal methionine start sites to leucine to ensure single isoform expression

  • AAV9-mediated gene transfer: Deliver specific GJA1 isoforms (such as GJA1-20k) in vivo using viral vectors (3 × 10^10 vector genomes)

  • Immunoblotting with domain-specific antibodies: Use antibodies targeting the N-terminus to specifically detect full-length protein

  • Functional rescue experiments: Determine isoform-specific functions by expressing individual isoforms in GJA1-depleted backgrounds

Studies have shown that the internally translated GJA1-20k isoform uniquely arranges actin to guide Cx43 delivery to cardiac intercalated discs, revealing distinct functions from the full-length protein .

How can researchers effectively deplete endogenous GJA1 to study loss-of-function phenotypes?

Multiple complementary approaches ensure effective depletion:

  • Antisense morpholino oligonucleotides (MO): Design MOs targeting the transcription start site to block translation of wild-type GJA1 mRNA

  • siRNA-mediated knockdown: Transfect cells with GJA1-specific siRNA and confirm depletion by immunoblotting

  • CRISPR/Cas9-mediated mutagenesis: Induce indel mutations at target sites in the GJA1 gene

  • Rescue experiments: Co-inject MO-mismatched GJA1 mRNA to confirm specificity of depletion phenotypes

Verification of phenotype specificity is crucial - studies have shown that while dominant-negative mutants cause similar phenotypes to GJA1 depletion, these mutants cannot rescue depletion phenotypes, suggesting distinct mechanisms .

What experimental systems best model GJA1 dysfunction in disease contexts?

Disease modeling requires tailored experimental approaches:

  • Oculodentodigital dysplasia (ODDD) models: Express GJA1 mutations associated with ODDD (such as R76H, which disrupts channel function)

  • Cardiac arrhythmia models: Study GJA1 in cardiomyocytes to evaluate effects on electrical coupling and contractile function

  • Cancer models: Investigate GJA1 domain functions in glioma invasion and proliferation using domain-specific targeting approaches

  • Organotypic culture systems: Maintain tissue architecture while manipulating GJA1 function for higher physiological relevance

Research in glioma models has revealed that different structural domains of GJA1 (extracellular loops, transmembrane domains, and intracellular carboxyl terminal) have distinct functions in tumor invasion and proliferation, suggesting domain-specific targeting as a therapeutic strategy .

How can post-translational modifications of GJA1 be effectively analyzed and their functional consequences determined?

Post-translational modification analysis requires sophisticated approaches:

  • Phospho-specific antibodies: Detect phosphorylation at specific sites (S365, S368, S369, S373)

  • Mass spectrometry-based phosphoproteomics: Identify novel modification sites and quantify modification stoichiometry

  • Site-directed mutagenesis: Replace modifiable residues with non-modifiable amino acids (e.g., S→A) to test functional consequences

  • Kinase inhibitor studies: Use specific inhibitors of PKA or PKC to determine kinase-specific effects on GJA1 function

Research has shown that PKC phosphorylation of S368 decreases gap junction channel permeability to small molecular weight solutes, while PKA-mediated phosphorylation of multiple sites promotes channel activity, demonstrating context-specific regulation of GJA1 function .

What methodological approaches can resolve contradictory findings regarding GJA1 localization in different cell types?

Resolving localization discrepancies requires multi-technique validation:

  • Multiple fixation protocols: Compare methanol fixation (5 minutes at -20°C) with paraformaldehyde fixation (4% PFA, 20 minutes at room temperature)

  • Super-resolution microscopy: Apply techniques like SIM or STORM to resolve subcellular localizations beyond diffraction limits

  • Fractionation studies: Separate cellular compartments biochemically to confirm protein distribution

  • Tissue-specific expression analysis: Compare localization patterns across different cell types (e.g., epithelial cells versus cardiac tissue)

Research has revealed unexpected localization patterns, including GJA1 in ciliary axonemes and pericentriolar regions, challenging traditional views of GJA1 as exclusively a gap junction protein at cell-cell contacts .

What are the most effective quality control parameters for assessing recombinant mouse GJA1 protein preparations?

Comprehensive quality assessment includes:

  • SDS-PAGE purity analysis: >85% purity is generally considered acceptable for research applications

  • Functional binding assays: Capacity testing (e.g., >200 pmol rabbit IgG binding per mg beads)

  • Endotoxin testing: Critical for preparations intended for in vivo applications

  • Mass spectrometry verification: Confirm protein identity and detect potential truncations or modifications

  • Particle size and distribution analysis: For bead-coupled preparations, uniform ~2 μm particle size with narrow distribution is optimal

How can recombinant mouse GJA1 be effectively utilized in high-throughput screening applications?

Implementation in screening platforms requires specialized approaches:

  • Pre-coupled magnetic beads: Utilize GJA1 protein conjugated to magnetic beads with uniform particle size (~2 μm) for high-throughput operations

  • Automation compatibility: Ensure preparations are compatible with liquid handling systems for screening applications

  • Multiplexed detection systems: Combine with other targets for parallel screening

  • Reporter systems: Develop fluorescence-based readouts for GJA1 activity or interaction

GJA1 pre-coupled magnetic beads offer advantages in high-throughput operations including convenient and fast capture of target molecules with high specificity and are compatible with automation equipment .

What novel methodological approaches are emerging for studying GJA1's role in ciliary function?

Cutting-edge techniques for ciliary studies include:

  • Whole-mount in situ hybridization: Distinguish between effects on cell fate specification versus ciliogenesis using markers like DNAH9

  • Ciliary isolation and length measurement: Isolate cilia from control versus experimental conditions to quantify morphological differences

  • Live imaging of ciliary dynamics: Monitor ciliary beating and formation in real-time

  • Cell-type specific conditional knockouts: Study GJA1 function in specific ciliated cell populations

Research has demonstrated that GJA1 is required for the formation of motile cilia in multiple systems, including Xenopus embryonic epithelium and human RPE1 cells, representing a previously unrecognized function of this gap junction protein .

How can researchers effectively distinguish between canonical gap junction functions and non-canonical roles of GJA1?

Differentiation strategies include:

  • Channel-dead mutants: Use mutants that maintain protein localization but lack channel function

  • Hemichannel-specific blockers: Apply pharmacological agents that selectively block undocked connexons

  • Truncation constructs: Express domain-specific fragments to isolate functions

  • Gap junction inhibitors: Use compounds like carbenoxolone to block channel function while preserving protein interactions

Recent research has revealed diverse non-canonical functions of GJA1, including roles in ciliogenesis through Rab11 regulation, actin cytoskeleton organization, and tumor cell invasion, emphasizing the importance of distinguishing between multiple concurrent functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.