Recombinant Mouse Gap junction alpha-10 protein (Gja10)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Gja10 is produced using multiple platforms to ensure solubility and functionality:

Expression Systems

  • Bacterial Systems: E. coli-derived Gja10 often includes fusion tags (e.g., His, GST) for purification but may lack post-translational modifications .

  • Yeast Systems: Used for producing glycosylated variants, enhancing stability .

  • Cell-Free Synthesis: Enables rapid production without cellular toxicity concerns .

Purification Protocols

  • Affinity chromatography (e.g., His-Tag, Strep-Tag)

  • Buffer formulation: Tris/PBS with stabilizers like trehalose

  • Purity: >85% confirmed by SDS-PAGE

Biological Roles

  • Facilitates electrical coupling in retinal horizontal cells, influencing visual processing .

  • Modulates neuroinflammation and neurodegeneration via glial communication .

  • Pseudogenization observed in echolocating bats correlates with vision loss, highlighting evolutionary adaptations .

Disease Associations

  • Altered expression reported in tumor microenvironments, suggesting roles in cancer progression .

  • Mutations linked to impaired cellular coupling in neurological disorders .

Experimental Uses

  • Antibody Development: Serves as an immunogen for anti-connexin antibodies .

  • Structural Studies: Used in cryo-EM and X-ray crystallography to map channel gating mechanisms .

  • Functional Assays: Measures intercellular dye transfer or calcium signaling in transfected cells .

Challenges and Limitations

  • Solubility Issues: Requires detergents or lipid bilayers for membrane protein stabilization .

  • Species Specificity: Mouse Gja10 shares 89% homology with human GJA10, necessitating cross-reactivity validation .

  • Functional Variability: Post-translational modifications differ across expression systems, affecting channel permeability .

Future Directions

  • High-Throughput Screening: Optimize connexin inhibitors using recombinant Gja10 in drug discovery .

  • Gene Therapy: Explore delivery of recombinant Gja10 to restore gap junction function in connexinopathies .

  • Structural Modeling: Refine atomic-resolution models to design modulators of intercellular communication .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. Should you need a particular format, kindly specify it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments default to standard blue ice packs. If you require dry ice packaging, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life of our product is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We aim to determine the tag type during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Gja10; Gap junction alpha-10 protein; Connexin-57; Cx57
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-505
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Gja10
Target Protein Sequence
MGDWNLLGGILEEVHSHSTIVGKIWLTILFIFRMLVLGVAAEDVWDDEQSAFACNTQQPG CNNICYDDAFPISLIRFWVLQIIFVSSPSLVYMGHALYRLRDFEKQRQKKKLYLRAQMEN PELDLEEQQRVDKELRRLEEQKRIHKVPLKGCLLRTYVLHILTRSVLEVGFMIGQYILYG FQMHPIYKCTQAPCPNSVDCFVSRPTEKTIFMLFMHSIAAISLLLNILEIFHLGIRKIMR ALDGKSSSGNTENETGPPFHSTNYSGTQQCMICSSLPERISLLQANNKQQVIRVNIPRSK SMWQIPHPRQLEVDVSCGKRDWAEKIESCAQLHVHSPCPHDRSARIQHPGQQPCHSVFGP KNAMSQSWFGTMTASQHRPSSALETWERSQGPEASGRSLTDRQSHFQGSDGSARESGVWT DRLGPGSRKASFLSRLMSEKGQRHSDSGSSRSLNSSCLDFSHGENSPSPLPSATGHRASM VSKSSHVDSPPHSSFIIHETYVYVY
Uniprot No.

Target Background

Function
Gap junctions are composed of clusters of closely packed pairs of transmembrane channels, known as connexons, facilitating the diffusion of low-molecular-weight materials between adjacent cells. This protein is implicated in tracer coupling between horizontal cells of the retina and may play a role in regulating horizontal cell patterning.
Gene References Into Functions
  1. Research indicates that mouse horizontal cells establish a coupled dendritic network through Cx57 and two coupled axon terminal networks, one formed by Cx50 and the other by Cx57 channels. PMID: 25823610
  2. Cx57-positive cells are clustered into distinct groups, forming diverse patterns in the olfactory epithelium. Within the sensory epithelial layer, hybridization signals are detectable in sublayers containing cell bodies of basal cells and olfactory neurons. PMID: 21840349
  3. In mice, the connexin genes Gjd2 (encoding mCx36), Gjc1 (encoding mCx45), and Gja10 (encoding mCx57) are expressed, along with a subset of four connexin genes, including the unique GJA9 (Cx59) and GJA10 (Cx62), which are detectable as transcript isoforms in the human retina. PMID: 20979653
  4. This study confirmed the expression of Cx57 in the horizontal cells of the retinal outer plexiform layer, the cerebellum, and pre-cerebellar regions. PMID: 20849935
  5. Cx57 is the first connexin identified in mammalian horizontal cells and the first whose expression is apparently limited to a single neuronal type. PMID: 15147297
  6. These data provide the first quantitative measurement of mouse horizontal cell receptive field size and validate the unique role of Cx57 in horizontal cell coupling and physiology. PMID: 16820008
  7. Reduced oocyte-granulosa cell gap junction communication and connexin expression were observed in a type 1 diabetic mouse model. PMID: 18829945
  8. This study presents the first detailed localization of connexin57 expression within mouse horizontal cells. PMID: 19177557
  9. The open channel probability of Cx57 gap junctions can be modulated by pH(i) with high efficiency within the physiologically relevant range, which may explain pH-dependent regulation of cell-cell coupling in retinal horizontal cells. PMID: 19433576

Show More

Hide All

Database Links
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Low levels were detected in skin, heart, kidney, testis, ovary, intestine. Expression not detected in brain, sciatic nerve or liver. According to PubMed:15147297 expression is detected only in horizontal cells in the inner nuclear layer of the retina and

Q&A

What is the molecular structure of mouse Gja10 and how does it compare to other connexins?

Mouse Gap junction alpha-10 protein (Gja10), also known as Cx62, functions as an essential component in the formation of gap junctions between cells. Like other connexins, Gja10 is involved in creating intercellular conduits that directly connect the cytoplasms of adjacent cells. Each gap junction channel forms through the docking of two hemichannels, with each hemichannel containing six connexin subunits .

The structure follows the typical connexin pattern with four transmembrane domains, two extracellular loops, one cytoplasmic loop, and cytoplasmic N- and C-terminal regions. The Gja10 gene is located on chromosome 6 in position 6q15 and contains only one exon, which is characteristic of most connexin genes . This single-exon structure simplifies genetic manipulation for recombinant protein production.

When compared with other connexin family members, Gja10 shows the typical structural conservation in the transmembrane and extracellular domains while exhibiting more sequence diversity in the cytoplasmic regions, particularly the C-terminus, which is often responsible for regulatory interactions specific to each connexin type.

What are the standard methods for expressing and purifying recombinant mouse Gja10?

The expression and purification of recombinant mouse Gja10 requires optimization of several parameters due to the membrane protein nature of connexins. The most effective approach involves:

Expression Systems:

  • Mammalian cell systems (particularly HeLa or N2A cells) yield the most functional protein as they contain the necessary machinery for proper folding and post-translational modifications

  • Baculovirus-insect cell systems provide an alternative with higher protein yields while maintaining most post-translational modifications

Purification Protocol:

  • Transfection with Gja10 expression vectors containing appropriate tags (His, FLAG)

  • Membrane fraction isolation (48-72 hours post-transfection)

  • Solubilization with mild detergents (typically n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography using tag-specific matrices

  • Size exclusion chromatography for highest purity

The freeze-fracture immunolabeling (FRIL) technique has been successfully used to verify the expression and localization of recombinant connexins in membrane fractions . This approach allows researchers to confirm that the 10-nm intramembranous particles observed are indeed composed of connexins and represent gap junction precursors (connexons or hemichannels).

How can researchers confirm the functional activity of recombinant Gja10?

Functional validation of recombinant Gja10 requires multiple complementary approaches:

Functional Assays:

Assay TypeMethodologyExpected ResultsLimitations
Dye TransferMicroinjection of Lucifer Yellow or similar gap junction-permeable dyeIntercellular spread of fluorescenceLimited quantitative precision
ElectrophysiologyDual whole-cell patch clampDirect measurement of junctional conductanceTechnical complexity
ATP ReleaseLuminometry following hemichannel activationATP detection in extracellular mediumIndirect measure of channel function
Metabolic CooperationCo-culture of wild-type and metabolically deficient cellsRescue of deficient cells via metabolite exchangeComplex interpretation

Researchers should note that measuring gap junction function requires appropriate cell systems with minimal endogenous connexin expression. The use of gap junction blockers (such as carbenoxolone or 18β-glycyrrhetinic acid) as controls is essential to confirm that the observed effects are specifically due to Gja10 activity.

What are the critical factors affecting Gja10 assembly into functional gap junctions?

The assembly of Gja10 into functional gap junctions follows a multi-step process with several critical checkpoints:

  • Formation Plaque Development: Gap junction "formation plaques" (FPs) serve as distinct membrane domains where Gja10 precursors accumulate. These domains represent specialized sites for the assembly process .

  • Membrane Matching: A crucial step involves the matching of formation plaques in apposed cells. This matching is a prerequisite for effective channel assembly and depends on appropriate cell-cell adhesion .

  • Progressive Membrane Approximation: During assembly, the distance between formation plaque membranes progressively decreases, facilitating the docking of hemichannels .

  • Particle Aggregation: 10-nm intramembranous particles (representing hemichannels) must aggregate properly within the formation plaques. The C-terminal domain plays a critical regulatory role in this process .

  • Regulatory Factors: Protein kinase C (PKC) activation can inhibit the assembly process, with the C-terminus serving as a target for this regulation .

Experimental manipulation of these factors through C-terminal truncations or mutations affects the efficiency of assembly and the functional properties of the resulting gap junctions. For instance, major C-terminal truncation of Cx43 (M257) results in delayed assembly, with particle aggregation occurring at lower densities .

How should researchers approach experimental design when studying Gja10 in disease models?

When investigating Gja10 in disease models, particularly cancer, researchers must consider:

  • Cancer Type Specificity: The role of connexins, including Gja10, varies considerably across different cancer types. For example, GJA10 mutations appear more frequently in small cell lung carcinomas (4.34%) and lung squamous cell carcinomas (3.45%) compared to an average of 0.6% across all tumor types .

  • Stage-Dependent Functions: Connexins can exhibit different roles depending on cancer progression stage. Initial experiments should clearly define whether early or late-stage processes are being investigated .

  • Control Selection: Appropriate controls must include both normal tissue and adjacent non-tumor tissue from the same organ, as baseline connexin expression varies significantly between tissues .

  • Multi-Parameter Analysis: Experimental designs should incorporate:

    • Expression analysis (mRNA and protein)

    • Localization studies (membrane vs. cytoplasmic)

    • Functional assessment (channel vs. non-channel functions)

    • Mutation analysis

  • Data Interpretation: Researchers should avoid overgeneralizing findings from one connexin to another. For instance, while Cx32 knockout in liver showed increased tumor incidence, Cx26 knockout did not show the same effect , highlighting the importance of isoform-specific analyses.

A comprehensive experimental approach would combine in vitro models, patient-derived samples, and genetically modified mouse models to establish causality rather than mere correlation.

What techniques are most effective for visualizing Gja10 dynamics in living cells?

Visualizing Gja10 dynamics in living cells requires sophisticated imaging approaches:

Current Gold Standard Techniques:

TechniqueApplicationSpatial ResolutionTemporal ResolutionSpecial Considerations
FRAP (Fluorescence Recovery After Photobleaching)Mobility and turnover~200 nmSeconds to minutesRequires Gja10-fluorescent protein fusion
TIRF (Total Internal Reflection Fluorescence)Near-membrane dynamics~100 nm lateralMillisecondsLimited to membrane-proximal regions
Super-resolution (PALM/STORM)Nanoscale organization10-20 nmSeconds to minutesRequires photoswitchable fluorophores
Live-cell FRILCorrelation of structure and dynamics<10 nmFixed timepointsComplex sample preparation

For optimal results, researchers should:

  • Create Gja10-fluorescent protein fusions with minimal functional impact

  • Validate that tagged proteins maintain normal trafficking and channel function

  • Use photoactivatable or photoconvertible fluorescent proteins to track specific subpopulations

  • Complement live imaging with freeze-fracture electron microscopy to correlate dynamic behaviors with structural changes

The immunolabeling of freeze-fracture replicas has proven particularly valuable for confirming that the 10-nm particles observed in formation plaques contain connexins and represent gap junction precursors .

How can researchers effectively study the role of Gja10 in metabolic cooperation between cells?

Investigating Gja10's role in metabolic cooperation requires specialized experimental designs:

  • Metabolic Coupling Assays:

    • Nucleotide transfer: Use cells deficient in hypoxanthine-guanine phosphoribosyltransferase (HGPRT) co-cultured with wild-type cells in HAT medium

    • Glucose metabolism: Employ 2-deoxyglucose phosphorylation transfer between coupled cells

    • Amino acid sharing: Measure the rescue of auxotrophic cells when paired with prototrophs

  • Selective Inhibition Strategies:

    • Targeted antibodies against extracellular loops of Gja10

    • Dominant-negative Gja10 mutants

    • Gja10-specific antisense or siRNA approaches

    • Small-molecule inhibitors with selectivity for Gja10 channels

  • Temporal Analysis:
    Metabolic cooperation testing should include:

    • Early phase (minutes): Direct metabolite transfer

    • Intermediate phase (hours): Adaptive responses

    • Long-term effects (days): Transcriptional changes

This approach can help distinguish between: (1) direct effects of Gja10-mediated metabolite exchange and (2) secondary consequences of altered cell-cell communication.

It's important to note that intercellular communication via gap junctions plays a critical role in "metabolic cooperation" between cells, and disruption of this communication has been associated with cancer development . For example, tumor promoters like 12-O-tetra-decanoylphorbol-13-acetate (TPA) cause rapid decreases in gap junction numbers .

How does phosphorylation affect Gja10 function and what methodologies best capture these changes?

Phosphorylation represents a major regulatory mechanism for gap junction proteins, including Gja10:

Key Phosphorylation Effects:

  • Channel gating (open probability)

  • Protein trafficking

  • Internalization and degradation

  • Protein-protein interactions

  • Assembly into gap junctions

Methodological Approaches:

MethodApplicationAdvantagesLimitations
Mass SpectrometryIdentification of phosphorylation sitesComprehensive, quantitativeRequires protein purification
Phospho-specific AntibodiesDetection of specific phosphorylation sitesIn situ detection possibleLimited by antibody availability
Phosphomimetic MutationsFunctional analysisDirect testing of site importanceMay not perfectly mimic phosphorylation
Kinase/Phosphatase InhibitorsRegulatory pathway analysisIdentifies responsible enzymesOff-target effects
FRET-based BiosensorsReal-time phosphorylation monitoringLive-cell compatibilityComplex design and validation

Protein kinase C (PKC) activation has been shown to inhibit gap junction assembly for some connexins. Interestingly, C-terminal truncation can disrupt this inhibitory regulation, suggesting that the C-terminus contains important regulatory phosphorylation sites .

To comprehensively study Gja10 phosphorylation, researchers should:

  • Map all potential phosphorylation sites using mass spectrometry

  • Correlate phosphorylation patterns with functional states

  • Identify responsible kinases and phosphatases

  • Create phosphosite mutants to determine functional significance

What approaches can researchers use to study Gja10 interactions with other connexins in heteromeric and heterotypic channels?

Gap junction channels can form heteromeric (different connexins in one hemichannel) and heterotypic (different hemichannels docking) configurations, adding complexity to Gja10 research:

Experimental Strategies:

  • Co-expression Systems:

    • Controlled ratio expression in communication-deficient cells

    • Bimolecular Fluorescence Complementation (BiFC) to visualize heteromerization

    • FRET-based proximity analysis between differently tagged connexins

  • Functional Discrimination:

    • Electrophysiological profiling of channel properties

    • Selective permeability to different dyes or metabolites

    • Pharmacological sensitivity profiles

  • Biochemical Approaches:

    • Co-immunoprecipitation with isoform-specific antibodies

    • Proximity ligation assays for in situ interaction detection

    • Cross-linking followed by mass spectrometry (XL-MS)

    • Blue native PAGE to preserve native protein complexes

  • Advanced Imaging:

    • Single-molecule localization microscopy to resolve mixed channel composition

    • Correlative light and electron microscopy to connect molecular identity with ultrastructure

The diversity in channel permeability between different connexins presents a significant challenge to researchers . Sorting out the transjunctional selectivity of heteromeric and heterotypic channels containing Gja10 remains a complex task, requiring multiple complementary approaches.

How is Gja10 expression and function altered in different mouse disease models?

Gja10 expression and function undergo specific changes in various disease contexts:

Cancer Models:
While general connexin alterations in cancer are well-documented, Gja10-specific data from mouse models is still emerging. Gap junction intercellular communication (GJIC) is frequently dysregulated in cancer, with different patterns observed depending on cancer type and stage . In human samples, GJA10 mutations are more frequent in small cell lung carcinomas (4.34%) and lung squamous cell carcinomas (3.45%) compared to the average across all tumors (0.6%) .

For mouse models specifically, researchers should note:

  • Connexin expression frequently changes during tumor development

  • Loss of gap junctional communication can be a hallmark of cancer promotion

  • Tumor promoters like TPA cause rapid decreases in gap junction numbers

  • Cancer-causing viruses can rapidly reduce gap junctional intercellular communication

Expression Pattern Analysis:
When investigating Gja10 in disease models, researchers should examine:

  • Changes in mRNA and protein levels

  • Alterations in subcellular localization

  • Post-translational modifications

  • Formation of functional channels vs. non-channel functions

What methodological considerations are important when developing Gja10-targeted therapeutics?

Development of therapeutics targeting Gja10 requires careful methodological considerations:

Target Validation Approaches:

  • Genetic models:

    • Conditional knockout mice

    • Knockin models with specific mutations

    • CRISPR/Cas9-mediated gene editing in relevant cell types

  • Target specificity:

    • Distinguishing Gja10 from other connexins

    • Identifying unique regulatory mechanisms

    • Exploiting tissue-specific expression patterns

Intervention Strategies:

ApproachMechanismAdvantagesChallenges
Mimetic PeptidesInterfere with connexin interactionsHigh specificity possibleLimited stability in vivo
Small MoleculesModulate channel gatingOral bioavailabilitySelectivity between connexins
Antibody-basedTarget extracellular loopsHigh specificityLimited tissue penetration
Gene TherapyRestore/suppress expressionLong-term correctionDelivery to target tissues
Antisense/siRNAReduce expressionHighly specificDelivery and stability

Efficacy Measurement:
Researchers need standardized assays to measure:

  • Changes in Gja10 expression levels

  • Alterations in channel function

  • Downstream effects on cellular phenotypes

  • Tissue-specific outcomes in disease models

The tissue-specific effects observed with different connexins suggest that therapeutic approaches must be carefully tailored to specific disease contexts. For example, while Cx32 knockout in liver showed increased tumor susceptibility, Cx26 knockout did not have the same effect .

What are the latest approaches for studying formation plaques in Gja10-expressing cells?

Studying formation plaques in Gja10-expressing cells has benefited from several advanced techniques:

State-of-the-Art Methodologies:

  • Freeze-Fracture Electron Microscopy:
    The combination of freeze-fracture with immunolabeling (FRIL) remains one of the most powerful approaches for studying gap junction formation plaques. This technique allows visualization of the characteristic 10-nm intramembranous particles and confirmation that they contain connexins .

  • Sterol Visualization:
    Filipin labeling of sterols combined with freeze-fracture electron microscopy helps demonstrate that formation plaques constitute distinct membrane "domains" with specific lipid compositions .

  • Quantitative Analysis:
    Modern approaches include quantitative analysis of:

    • Formation plaque area

    • Number and density of 10-nm particles

    • Degree of particle aggregation

    • Progressive reduction of distance between formation plaque membranes

  • Correlative Microscopy:
    Combining live-cell imaging with subsequent electron microscopy of the same samples provides temporal information about formation plaque development and maturation.

  • Super-Resolution Approaches:
    Techniques such as STORM, PALM, and STED microscopy are now being applied to visualize the nanoscale organization of connexins during formation plaque development.

These methodologies have provided valuable insights into key aspects of the assembly model, including the matching of formation plaques in apposed cells, enrichment of 10-nm particles, depletion of smaller particles in formation plaques, and the steps in aggregation of 10-nm particles into gap junctions .

How can researchers effectively analyze the permeability properties of Gja10-containing channels?

Analyzing the permeability properties of Gja10-containing channels requires specialized approaches to address the complexity of channel selectivity:

Comprehensive Permeability Assessment:

  • Multi-Tracer Approach:
    Testing the permeability to a panel of molecules with different properties:

    • Size (molecular weight range: 200-1000 Da)

    • Charge (positive, negative, neutral)

    • Hydrophobicity (range of logP values)

    • Structure (linear, branched, cyclic)

  • Quantitative Measurement Techniques:

TechniqueApplicationAdvantagesLimitations
FRAP with defined tracersDirectional permeabilityLive cell compatibilityLimited to fluorescent molecules
Local Activation of Molecular Fluorescent ProbesSingle-channel resolutionHigh sensitivityComplex implementation
Electrophysiology with permeant ionsDirect conductance measurementReal-time dataLimited to ionic permeants
Mass SpectrometryEndogenous metabolite transferComprehensive detectionEndpoint measurement
  • Computational Modeling:

    • Molecular dynamics simulations of Gja10 pore structure

    • Prediction of permeability based on physical and chemical properties

    • Comparison with experimental data to refine models

Understanding the diversity in channel permeability between different connexins represents one of the most significant challenges in the field . This diversity contributes to the tissue-specific functions of different connexins and their variable roles in disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.