Recombinant Mouse Gap junction alpha-6 protein (Gja6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Gja6; Gap junction alpha-6 protein; Connexin-33; Cx33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Gja6
Target Protein Sequence
MSDWSALHQLLEKVQPYSTAGGKVWIKVLFIFRILLLGTAIESAWSDEQFEFHCNTQQPG CENVCYDHAFPISHVRLWVLQVIFVSVPILLYLAHAYYVVRQNKKLNKQEEELEAAHFNE ASVERHLETIAGEQFKCGSEEQSKVKMRGRLLLTYMASIFFKSVFEMAFLLIQWYIYGFT LSALYICEQSPCPRRVDCFLSRPTEKTIFILFMFVVSVVSFVLDIIELFYVLFKAIKNRM RKAEDEVYCDELPCPSHVSSSTVLTTIDSSEQAVPVELSSVCI
Uniprot No.

Target Background

Function
Gap junctions are specialized intercellular channels formed by clusters of closely packed pairs of transmembrane channels, known as connexons. These channels facilitate the diffusion of low molecular weight materials between adjacent cells.
Gene References Into Functions
  1. Research findings indicate that the interaction of Cx33 with Cx43 within the same heteromeric complex can contribute to channel instability by altering the phosphorylation status of Cx43. This occurs independently of the regulation by the c-Src kinase. PMID: 20152878
Database Links
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is Gap Junction Protein Alpha-6 (Gja6) and what is its structural organization?

Gap Junction Protein Alpha-6 (Gja6), also known as Connexin-33 (Cx33), belongs to the connexin family, specifically the alpha-type (group II) subfamily. It is a structurally-related transmembrane protein that assembles to form vertebrate gap junctions. Connexins are four-pass transmembrane proteins with both C-terminal and N-terminal cytoplasmic domains, a cytoplasmic loop (CL), and two extracellular loops (EL-1 and EL-2). The protein's structure is critical for its function in forming gap junction channels between adjacent cells.

Each functional gap junction is composed of two hemichannels or connexons, with each connexon constructed from six connexin molecules. This hexameric arrangement creates a pore that allows for intercellular communication, facilitating the exchange of small molecules and ions between cells. The specific arrangement of these connexin molecules within the hemichannel determines the selectivity and permeability characteristics of the gap junction.

Why is recombinant mouse Gja6 important for research applications?

Recombinant mouse Gja6 serves as a critical tool for studying gap junction biology in a controlled experimental setting. Unlike native protein isolation, which may yield variable amounts of protein with potential contaminants, recombinant protein production allows for consistent quality and quantity of the target protein. Recombinant production enables researchers to investigate structure-function relationships, perform detailed biochemical analyses, develop antibodies, and establish screening platforms for potential modulators of gap junction function.

For mouse Gja6 specifically, the recombinant protein enables comparative studies between species and provides insights into tissue-specific functions in mouse models that may be relevant to human disease states. Since gap junctions are essential for many physiological processes, including coordinated cardiac muscle depolarization and proper embryonic development, having purified recombinant protein facilitates the study of these processes at the molecular level.

What is the optimal expression system for producing recombinant mouse Gja6?

Based on similar recombinant protein production protocols, the optimal expression system for mouse Gja6 would likely be a prokaryotic system using E. coli BL21(DE3) strain cultured in TB (Terrific Broth) medium. This system offers high protein yields with relatively simple culture conditions. For membrane proteins like Gja6, expression should be conducted at lower temperatures (approximately 15°C) with moderate IPTG concentrations (around 0.25 mM) to prevent the formation of inclusion bodies and promote proper protein folding.

The expression construct should include the full extracellular domain of mouse Gja6, potentially with additional tags for purification (such as His-tag or GST-tag). Expression conditions need to be optimized by testing various parameters including:

  • Induction temperature (15-37°C)

  • IPTG concentration (0.1-1.0 mM)

  • Induction time (4-24 hours)

  • Culture medium composition (LB, TB, 2YT)

These optimization steps are crucial as membrane proteins like connexins often present challenges in recombinant expression due to their hydrophobic domains and complex folding requirements.

What purification strategy yields the highest purity for recombinant mouse Gja6?

A multi-step purification strategy is recommended for obtaining high-purity recombinant mouse Gja6. Based on similar membrane protein purification protocols, the following approach would be effective:

  • Cell lysis using buffers containing 2% sarkosyl or similar detergents to solubilize the membrane protein efficiently

  • Initial purification using affinity chromatography (if the construct contains an affinity tag)

  • Secondary purification via ion-exchange chromatography to remove contaminants with different charge properties

  • Final polishing step using size-exclusion chromatography to eliminate aggregates and obtain homogeneous protein

The addition of stabilizing agents such as glycerol (10-15%) and reducing agents like DTT or β-mercaptoethanol in purification buffers helps maintain protein stability. It's crucial to validate protein purity using SDS-PAGE and Western blotting with anti-Gja6 antibodies to confirm identity.

Purification StepBuffer CompositionExpected YieldPurity Level
Cell Lysis50 mM Tris-HCl pH 8.0, 150 mM NaCl, 2% sarkosylTotal protein extractLow
Affinity Chromatography50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.1% detergent, 20-250 mM imidazole gradient40-60% recoveryMedium
Ion-Exchange20 mM Phosphate buffer pH 7.4, 50-500 mM NaCl gradient, 0.05% detergent70-80% recoveryHigh
Size-Exclusion20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% detergent, 10% glycerol90-95% recoveryVery High

How can recombinant mouse Gja6 be used to study gap junction formation in vitro?

Recombinant mouse Gja6 can be employed in several experimental approaches to study gap junction formation in vitro:

Liposome Reconstitution Assays: Purified recombinant Gja6 can be reconstituted into liposomes to study channel formation and permeability. This involves incorporating the protein into synthetic lipid bilayers and measuring the exchange of fluorescent dyes or electrical conductance between liposomal compartments. These assays allow researchers to study the biophysical properties of Gja6 channels in a controlled environment.

Cell Culture Transfection Studies: Gap junction-deficient cell lines can be transfected with Gja6 expression constructs to examine the ability of the protein to form functional channels. This approach enables the investigation of trafficking, assembly, and functional properties of Gja6 in a cellular context. Dye transfer assays using fluorescent tracers like Lucifer yellow or calcein can quantify gap junctional communication.

Atomic Force Microscopy (AFM) and Electron Microscopy: These techniques can visualize the structural organization of recombinant Gja6 in reconstituted systems. AFM can provide information about channel dimensions and topography, while electron microscopy can reveal the higher-order arrangement of connexons within membranes.

When designing these experiments, it's essential to include appropriate controls, such as known functional connexins (e.g., Cx43) and non-functional mutants, to validate the experimental system and provide comparative data.

What are the key considerations when designing antibodies against mouse Gja6?

Designing effective antibodies against mouse Gja6 requires careful consideration of several factors:

Epitope Selection: The most immunogenic and accessible regions of Gja6 are typically found in the cytoplasmic loop and C-terminal domain. These regions show higher sequence variability among connexin family members, making them ideal targets for specific antibody generation. Avoiding the highly conserved transmembrane domains increases antibody specificity.

Cross-Reactivity Testing: Any antibody developed against mouse Gja6 should be rigorously tested for cross-reactivity against other connexin family members, particularly those with high sequence homology. This validation should include Western blotting, immunoprecipitation, and immunohistochemistry using tissues known to express or lack Gja6.

Validation in Multiple Assays: The antibody should be validated using multiple techniques:

  • Western blotting to confirm specificity and apparent molecular weight

  • Immunofluorescence to verify cellular localization

  • Immunoprecipitation to assess ability to pull down native protein

  • ELISA to determine binding affinity and sensitivity

Both monoclonal and polyclonal antibodies offer distinct advantages. Monoclonal antibodies provide consistent specificity but recognize only a single epitope, while polyclonal antibodies offer higher sensitivity by recognizing multiple epitopes but may have batch-to-batch variability.

How can functional differences between recombinant and native mouse Gja6 be assessed and reconciled?

Assessing functional differences between recombinant and native mouse Gja6 requires a multi-faceted approach to identify and address potential disparities:

Comparative Biophysical Analysis: Electrophysiological techniques such as patch-clamp recordings can measure channel conductance and gating properties of both recombinant and native Gja6. Any differences in these parameters may indicate alterations in protein folding or post-translational modifications. Similarly, dye transfer assays can compare permeability characteristics between recombinant and native channels.

Post-Translational Modification Profiling: Mass spectrometry analysis can identify post-translational modifications (PTMs) present in native Gja6 that may be absent in recombinant protein. Common PTMs affecting connexin function include phosphorylation, ubiquitination, and SUMOylation. If critical PTMs are identified in native protein, expression systems capable of introducing these modifications (such as mammalian or insect cell systems) should be considered for recombinant production.

Protein-Protein Interaction Analysis: Co-immunoprecipitation followed by mass spectrometry can identify binding partners of native Gja6 that may influence its function. These interactions can then be reconstituted with recombinant protein to assess their impact on channel properties.

Structural Comparison: Circular dichroism spectroscopy and limited proteolysis can compare the secondary structure and conformational stability of recombinant versus native Gja6, providing insights into potential folding differences.

To reconcile identified differences, researchers should consider modifying expression systems, incorporating relevant PTMs enzymatically, or including necessary binding partners in functional assays with recombinant protein.

What experimental approaches can elucidate the role of mouse Gja6 in spermatogenesis and male fertility?

Mouse Gja6 (Connexin-33) has been implicated in spermatogenesis and male fertility, necessitating specialized experimental approaches to investigate its specific roles:

Conditional Knockout Models: Generation of testis-specific conditional Gja6 knockout mice allows temporal control over gene deletion, enabling the study of Gja6 function at specific stages of spermatogenesis without affecting other tissues where it may be expressed. Analysis should include fertility assessment, sperm count, morphology, and motility evaluations.

Cell-Type Specific Expression Analysis: Single-cell RNA sequencing of testicular cells can identify the specific cell types expressing Gja6 during spermatogenesis. This information can guide more targeted functional studies in relevant cell populations.

Gap Junction Coupling Analysis in Seminiferous Tubules: Ex vivo studies of seminiferous tubules using techniques such as scrape-loading dye transfer assays or local electrophysiological recordings can assess gap junctional communication between Sertoli cells and developing germ cells. These approaches can determine whether Gja6 forms functional channels in the testis and how these channels contribute to spermatogenesis.

Protein-Protein Interaction Studies: Yeast two-hybrid screening or proximity labeling approaches (BioID, APEX) can identify testis-specific binding partners of Gja6, potentially revealing mechanisms by which this connexin influences spermatogenesis.

Recombinant Protein Application: Purified recombinant Gja6 can be used to generate blocking antibodies or peptides that specifically inhibit Gja6 function, allowing for acute disruption of its activity in ex vivo testicular preparations.

These approaches collectively can elucidate the molecular mechanisms by which Gja6 contributes to proper spermatogenesis and male fertility, potentially identifying therapeutic targets for male infertility treatment.

What are the best practices for presenting and analyzing data from Gja6 protein expression experiments?

Effective presentation and analysis of Gja6 protein expression data requires adherence to rigorous scientific standards:

Optimal Visualization Tools: For Gja6 expression data, employ appropriate visualization methods based on data type. Western blot quantification should be presented as bar graphs with error bars representing standard deviation or standard error. Immunohistochemistry results should include representative images with scale bars and quantification across multiple samples. Flow cytometry data should be displayed as histograms or dot plots with clearly defined positive and negative populations.3

Statistical Analysis Considerations: Statistical methods should be selected based on data distribution and experimental design. For comparing Gja6 expression across different conditions:

  • Use t-tests for comparing two groups when data is normally distributed

  • Apply ANOVA with appropriate post-hoc tests for multiple group comparisons

  • Utilize non-parametric tests (Mann-Whitney, Kruskal-Wallis) when normality cannot be assumed

Report exact p-values rather than threshold significance (e.g., p=0.032 rather than p<0.05) and include information about statistical tests in figure legends.3

Results Section Structure: When writing about Gja6 expression data, organize the results section to first address any technical challenges encountered during protein expression and purification, then present the main findings regarding expression levels across different conditions, followed by additional analyses of protein functionality or interactions. Use clear topic sentences to guide readers through the logical progression of results.3

Table and Figure Design: Tables presenting Gja6 expression data should have the independent variable (e.g., experimental conditions) arranged vertically on the left and dependent variables (e.g., expression levels, purity percentages) arranged horizontally. Figures should be labeled clearly with "Figure X" below the image and include comprehensive captions that allow understanding without referring to the main text.3

How can contradictory results in Gja6 functional studies be reconciled and addressed?

Contradictory results in Gja6 functional studies can arise from various sources, requiring systematic approaches to reconciliation:

Methodological Differences Assessment: Create a comprehensive comparison table documenting methodological variations between contradictory studies, including:

  • Protein source (recombinant vs. native)

  • Expression system used for recombinant production

  • Purification method and buffer composition

  • Experimental conditions (pH, temperature, ionic strength)

  • Cell types or models used for functional assays

These differences often explain discrepancies in results and highlight the context-dependent nature of Gja6 function. 3

Replication with Standardized Protocols: Design experiments that systematically test variables identified in the methodological assessment. This controlled approach can determine which factors contribute most significantly to the observed contradictions.

Integration of Multiple Assay Types: When different assay types yield contradictory results, employ orthogonal techniques to measure the same parameter. For example, if electrophysiological and dye transfer assays produce conflicting data about Gja6 channel permeability, incorporate additional methods such as metabolite transfer assays or atomic force microscopy to provide complementary evidence. 3

Biological Context Consideration: Assess whether contradictions reflect genuine biological variability rather than technical issues. Gja6 function may naturally vary depending on:

  • Cell type-specific regulatory mechanisms

  • Developmental stage

  • Presence of interacting proteins

  • Post-translational modification status

When reconciling contradictions, present multiple interpretations of the data and explicitly acknowledge limitations. This approach maintains scientific integrity while advancing understanding of the complex biology of gap junction proteins. 3

What emerging technologies could enhance our understanding of mouse Gja6 function and regulation?

Several cutting-edge technologies are poised to revolutionize Gja6 research:

Cryo-Electron Microscopy (Cryo-EM): This technique can resolve high-resolution structures of membrane proteins like Gja6 in near-native states. Applied to purified recombinant Gja6, cryo-EM could reveal detailed structural insights into channel assembly, pore architecture, and conformational changes associated with gating. These structural data would inform rational design of Gja6-specific modulators and clarify molecular mechanisms of channel regulation.

CRISPR-Cas9 Gene Editing: Precise genome editing enables:

  • Creation of knock-in mice expressing tagged versions of Gja6 for in vivo tracking

  • Introduction of specific disease-associated mutations to study their functional consequences

  • Development of cell lines with inducible Gja6 expression for temporal studies of channel formation

These genetic tools allow investigation of Gja6 function in physiologically relevant contexts with unprecedented precision.

Optogenetic Approaches: Engineering light-sensitive domains into Gja6 could enable temporal and spatial control of channel function in living cells. This approach would allow researchers to study the acute effects of Gja6 channel opening or closing on cellular physiology with millisecond precision.

Single-Molecule Imaging: Techniques like single-molecule fluorescence resonance energy transfer (smFRET) can track conformational changes in individual Gja6 channels in real-time. This approach reveals the dynamics of channel gating and how these processes are influenced by binding partners or post-translational modifications.

Proteomics and Interactomics: Advanced mass spectrometry techniques coupled with proximity labeling approaches (BioID, APEX) can comprehensively identify the Gja6 interactome in different tissues and physiological states, uncovering novel regulatory mechanisms and functional partnerships.

How might comparative studies between mouse and human gap junction proteins inform translational research?

Comparative studies between mouse and human gap junction proteins offer valuable insights for translational research:

Structure-Function Relationship Analysis: Sequence alignment and homology modeling of mouse Gja6 and its human orthologs can identify conserved domains crucial for channel function versus species-specific regions that may account for functional differences. These analyses guide the development of targeted interventions with greater translational potential.

Cross-Species Expression Studies: Expressing human gap junction proteins in mouse models and vice versa allows assessment of functional conservation and species-specific regulation. This approach helps determine whether mouse models accurately recapitulate human gap junction biology in specific physiological contexts.

Disease-Associated Mutation Comparison: Analyzing the effects of equivalent mutations in mouse and human gap junction proteins provides insights into conserved pathogenic mechanisms. If a mutation causes similar phenotypes across species, mouse models become more valuable for testing therapeutic approaches.

Pharmacological Response Profiling: Comparative pharmacology studies can reveal species-specific responses to gap junction modulators. These differences are critical considerations when using mouse models to test potential therapeutics targeting gap junction function in human diseases.

Immunogenicity Assessment: Understanding structural differences between mouse and human gap junction proteins informs the design of antibodies or vaccines with enhanced cross-reactivity or species specificity, depending on the research or therapeutic goal.

The ultimate goal of these comparative approaches is to determine which aspects of mouse Gja6 biology can reliably inform human gap junction physiology and pathology, strengthening the translational value of basic research findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.