Recombinant Mouse Gap junction beta-1 protein (Gjb1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Communication

Gjb1 enables radial diffusion pathways in myelinating cells, critical for:

  • Metabolic Support: Transport of ions (K⁺, Ca²⁺), second messengers (cAMP, IP₃), and metabolites (<1 kDa) between Schwann cells and axons .

  • Myelin Maintenance: Facilitates communication across myelin layers, ensuring efficient nerve signal transmission .

  • Pathological Implications: Mutations disrupt gap junction function, leading to X-linked Charcot-Marie-Tooth disease (CMTX1) via demyelination and axonal degeneration .

Research Applications of Recombinant Mouse Gjb1

Recombinant Gjb1 is widely used to study:

  • CMTX1 Pathogenesis: Mutant protein aggregation, intracellular trafficking defects, and stress granule formation .

  • Gap Junction Dynamics: Channel permeability assays and intercellular communication studies .

  • Therapeutic Development: Screening for small molecules that restore connexon function .

Table 2: Key Research Applications

ApplicationExperimental ModelFindingsReference
Mutation AnalysisHeLa cells expressing Gjb1 mutantsMutants (e.g., F31S, W44G) form intracellular aggregates, impairing cell viability
Channel PermeabilityPaired Xenopus oocytesPathogenic mutants (e.g., R183C) show reduced dye transfer efficiency
Stress ResponseRT4 Schwann cellsMutant Gjb1 triggers stress granule formation, linked to neurotoxicity

Production and Purification Methods

Recombinant Mouse Gjb1 is produced using:

  • Expression Systems:

    • E. coli: Cost-effective for large-scale production but may lack post-translational modifications .

    • HEK293 cells: Retain native protein folding and modifications .

  • Tags: His, GST, or Fc tags for affinity purification .

Table 3: Expression Systems and Yields

SystemAdvantagesLimitationsReference
E. coliHigh yield, low costNo glycosylation or phosphorylation
HEK293Native post-translational modificationsLower yield, higher cost

Challenges in Recombinant Gjb1 Studies

  • Protein Aggregation: Mutants like R220Pfs*23 form cytosolic aggregates, complicating functional assays .

  • Solubility: Requires detergents (e.g., NP-40, SDS) for extraction, affecting downstream applications .

  • Functional Assays: Measuring GJ permeability requires specialized techniques (e.g., dye transfer in oocytes) .

Recent Advances and Studies

  • Novel Mutants: Identification of F31S and W44G mutations in Chinese CMTX1 families revealed disrupted Gjb1 trafficking and stress responses .

  • Non-Coding Mutations: The c.-103C>T variant in the 5’ UTR reduces translation efficiency without affecting IRES activity .

  • Biophysical Correlations: Severe GJ dysfunction (e.g., p.C173Y) correlates with early disease onset and severe neuropathy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we prioritize developing specified tags if requested.
Synonyms
Gjb1; Cxn-32; Gap junction beta-1 protein; Connexin-32; Cx32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Gjb1
Target Protein Sequence
MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC NSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEV KRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCEAFPCPNTVDCF VSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLS PEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
Uniprot No.

Target Background

Function
Gap junctions comprise clusters of closely packed transmembrane channel pairs (connexons) enabling the diffusion of low-molecular-weight materials between adjacent cells.
Gene References Into Functions
  1. Leu89Pro substitution in CX32's second transmembrane domain disrupts protein trafficking, inhibiting CX32 gap junction assembly and potentially causing peripheral neuropathy. PMID: 27367520
  2. Cell-surface and secreted CSF-1 isoforms exhibit opposing effects on macrophage activation and disease progression in connexin32-deficient mice. PMID: 26865613
  3. Endothelial Cx32 blockade increases TNF-alpha-induced tissue factor expression and cell-cell interaction via ICAM1, indicating Cx32 modulation of TF expression during vascular inflammation. PMID: 25171777
  4. Cx32 plays a role in non-myelinating and regenerating Schwann cells, contributing to axonal maintenance, remyelination, and peripheral nerve regeneration. PMID: 25447941
  5. Increased hepatocellular carcinoma incidence in male Cx32 knockout mice suggests Cx32 deficiency enhances tumor promotion and progression. PMID: 23001129
  6. Cx32 therapy improves gap junctional conductance but results in larger infarct size and lacks antiarrhythmic efficacy. PMID: 22374989
  7. Connexin30 knockout mice exhibit altered connexin26 and connexin32 expression patterns in glial cells and leptomeninges. PMID: 22098503
  8. Cx32 functionally replaces Cx26 in the mouse cochlea, resulting in near-normal hearing. PMID: 21813206
  9. Increased Cx29 and Cx32 expression at injury borders suggests their involvement in propagating injury-related and/or regeneration signals after acute brain injury. PMID: 20926974
  10. Oligodendrocyte-astrocyte gap junction coupling is altered in Cx32 or Cx47 knockout mice; Cx32 deficiency more significantly affects oligodendrocyte-oligodendrocyte coupling. PMID: 21396451
  11. Cx32 Asn(175) is crucial for heterotypic docking and functional gap junction channel formation between Cx32 and Cx26 hemichannels. PMID: 21478159
  12. Altered Cx32 expression, loss of intercellular Cx32, and increased intracytoplasmic Cx32 contribute to gastric adenocarcinoma formation. PMID: 21082351
  13. Cx32 protects endothelial cells from inflammation by regulating cytokine expression and maintaining vascular function. PMID: 21036166
  14. Oligodendrocytes in white matter form a functional syncytium primarily through Cx47 and Cx32, with astrocytic connexins influencing network size. PMID: 20468052
  15. Increased macrophages in demyelinating nerves of Cx32-deficient mice suggest macrophage involvement in genetically determined demyelination. PMID: 11849753
  16. Cx32 induces tight junction expression and function in hepatocytes. PMID: 11978007
  17. Calmodulin (CaM) directly affects chemical gating of Cx32, as shown by CaM mutant studies and CaM-Cx32 colocalization in the liver. PMID: 12064602
  18. Cx32 gene deficiency in mice leads to severe acute pancreatitis and reduced acinar cell apoptosis in the exocrine pancreas. PMID: 12557153
  19. Expression profile of Gjb1 (Cx32) in the developing mouse cochlea. PMID: 12617848
  20. Increased proliferating nestin+ and NG2+ oligodendrocyte progenitors in the dentate gyrus of connexin32-deficient mice. PMID: 12629180
  21. Cx47 deficiency causes nerve fiber vacuolation; Cx32/Cx47 double deficiency leads to action tremor and early death. PMID: 12805295
  22. Mice lacking both Cx47 and Cx32 die from CNS myelin sheath abnormalities, vacuolation, and neuronal loss. PMID: 12843301
  23. Comparative mapping of Y1 and Y5 receptor subtypes in the brain provides insights into NPY neural circuitry. PMID: 12900929
  24. Cx32 is detected in gap junctions in Schmidt-Lanterman incisures and between myelin layers. PMID: 15056698
  25. Cx32 localization on the outer membrane of large myelin sheaths. PMID: 15293232
  26. Hepatic response to endotoxin is impaired in the absence of Cx32. PMID: 15336523
  27. Cx32 acts as a lung tumor suppressor; Cx32 deficiency increases lung tumor incidence. PMID: 15492231
  28. Cx32 expression influences tight junctions through Mag-1 modulation. PMID: 15558322
  29. PKC-dependent phosphorylation at Ser368 regulates Cx43 junction permeability. PMID: 16709897
  30. Cx43alpha1 mediates crosstalk with cell signaling pathways regulating polarized cell movement. PMID: 16914489
  31. Cx43 plays key roles in Sertoli cell development. PMID: 17229929
  32. Abnormal neurodevelopment in Cx43 conditional knockout mice may explain behavioral disturbances. PMID: 17311295
  33. Cx32 protects hematopoietic stem cells from chemical abrasion and leukemogenic effects. PMID: 17463168
  34. Absence of Cx32 immunofluorescent puncta in the suprachiasmatic nucleus. PMID: 17904757
  35. Cx29 and Cx32 homomeric interactions require the N-terminus, transmembrane domains, and extracellular loops. PMID: 17972320
  36. Cx43 ablation in oocytes and reduced expression in surrounding somatic cells allows normal oogenesis but impairs implantation. PMID: 18005958
  37. Decreased connexin 43 in testis of mutant mice with impaired spermatogenesis. PMID: 18162455
  38. Atomistic model analysis of the Cx32 connexon. PMID: 18648547
  39. Glial growth factor 2 upregulates Cx32 in Schwann cells. PMID: 19218461
  40. Cx32 negatively controls thyrotropin-activated thyroid growth via the cAMP pathway but may positively affect oncogene-triggered growth. PMID: 19509066
  41. Effects of metabolic inhibition on mouse connexin 32 hemichannel calcium-metabolizing activity. PMID: 19587218
Database Links
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is the molecular structure of mouse Gjb1 and how does it compare to human GJB1?

Mouse Gjb1 (Connexin 32) is a 32 kDa transmembrane protein consisting of 283 amino acids that belongs to the beta family of gap junction proteins. The protein shares a common topology with other connexins, featuring four transmembrane alpha-helical domains, two extracellular loops, a cytoplasmic loop, and cytoplasmic N- and C-termini .

Structurally, mouse Gjb1 and human GJB1 share high sequence homology (>90%), with the most conserved regions being the transmembrane and extracellular domains. The amino acid differences between species are primarily located in the less conserved cytoplasmic regions, particularly the C-terminal domain . These structural similarities make mouse models valuable for studying human GJB1-associated diseases, though researchers should remain aware of species-specific differences when translating findings.

The connexin protein forms hexameric complexes called connexons that facilitate the movement of ions and small molecules between cells via gap junctions. These channels allow passive diffusion of molecules up to 1 kDa, including nutrients, metabolites (glucose), ions (K+, Ca2+), and second messengers (IP3, cAMP) .

What are the key expression patterns of Gjb1 in mouse tissues?

Gjb1 exhibits tissue-specific expression patterns in mice that are critical to consider when designing experiments:

Tissue TypeExpression LevelFunctional Significance
LiverHighMetabolic coordination between hepatocytes
Peripheral nervous systemHighMyelination and axonal function in Schwann cells
Central nervous systemModeratePresent in oligodendrocytes
CochleaModerateForms gap junctions between supporting cells
SkinLowLimited expression in specific cell types

The protein is particularly abundant in myelinating cells (Schwann cells in the peripheral nervous system and oligodendrocytes in the central nervous system), where it forms channels that facilitate transfers between layers of the myelin . This tissue-specific expression pattern correlates with the pathologies observed in Gjb1 mutation models, particularly peripheral neuropathies.

What is the functional significance of Gjb1 in intercellular communication?

Gjb1 plays a crucial role in direct cell-to-cell communication through the formation of gap junction channels. These channels allow the coordinated transfer of:

  • Electrical signals (ions) - particularly important in excitable tissues

  • Metabolites - including glucose and amino acids

  • Second messengers - such as cAMP, IP3, and Ca2+

  • Small regulatory molecules - less than 1 kDa in size

Within Schwann cells of the peripheral nervous system, Gjb1 forms channels that facilitate transfers between layers of myelin, which is essential for proper nerve conduction . The protein's specific permeability properties are determined by its unique amino acid composition, particularly charged amino acids positioned in the amino terminus (M1 and D2) and first extracellular loop (E42) . These molecular determinants are critical for understanding the selective permeability of Gjb1-containing channels.

What are the optimal conditions for reconstitution and storage of recombinant mouse Gjb1 protein?

Based on established protocols for similar connexin proteins, recombinant mouse Gjb1 requires careful handling to maintain functionality:

Reconstitution Protocol:

  • Recombinant Gjb1 is typically supplied as a lyophilized powder

  • Reconstitute at 50 μg/mL in a mild acidic buffer (e.g., 4 mM HCl)

  • For increased stability, include a carrier protein such as human or bovine serum albumin (0.1%)

  • Allow complete dissolution at room temperature with gentle agitation (do not vortex)

  • Once reconstituted, aliquot to avoid repeated freeze-thaw cycles

Storage Recommendations:

  • Store lyophilized protein at -20°C to -80°C

  • Store reconstituted protein in single-use aliquots at -80°C

  • Use a manual defrost freezer to avoid temperature fluctuations

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

For carrier-free applications (where the presence of BSA may interfere with experiments), special handling is required. Carrier-free preparations typically show reduced stability and should be used immediately after reconstitution when possible.

What antibody-based detection methods are most effective for studying mouse Gjb1?

Several antibody-based approaches have proven effective for detecting and studying mouse Gjb1:

Recommended Antibodies:
Mouse monoclonal antibodies against Connexin 32 (Gjb1) that recognize the 27-32 kDa protein have been validated for multiple applications . When selecting antibodies, consider the following:

  • Application-specific considerations:

    • For immunohistochemistry: Antibodies recognizing extracellular domains often work better on lightly-fixed tissues

    • For Western blotting: Antibodies targeting the C-terminus typically provide cleaner results

    • For immunoprecipitation: Use antibodies validated specifically for this application

  • Detection systems:

    Fluorophore/LabelEx/Em (nm)Laser lineBest Application
    CF®405S404/431405DAPI channel microscopy
    CF®488A490/515488GFP/FITC channel, higher sensitivity
    CF®568562/583532, 561RFP/TRITC channel, reduced autofluorescence

For antibody validation, expression of recombinant connexins in connexin-free HeLa cells has been established as a reliable control method . This approach allows researchers to confirm antibody specificity before application in more complex experimental systems.

How can researchers effectively study the electrophysiological properties of recombinant Gjb1 channels?

Studying the electrophysiological properties of Gjb1 channels requires specialized techniques:

Dual Whole-Cell Patch Clamp Approach:

  • Express Gjb1 in communication-deficient cell lines (e.g., HeLa cells or N2A cells)

  • Form cell pairs with either homotypic (Gjb1-Gjb1) or heterotypic (Gjb1-other connexin) configurations

  • Measure junctional conductance and voltage-dependent gating using dual whole-cell patch clamp

  • Apply transjunctional voltage steps (typically ±100 mV in 10-20 mV increments)

  • Analyze current-voltage (I-V) relationships to determine rectification properties

Key Parameters to Measure:

  • Unitary conductance (single-channel conductance)

  • Voltage-dependent gating properties

  • Chemical gating sensitivity (pH, Ca2+)

  • Selective permeability to different molecules

  • Rectification properties (especially in heterotypic channels)

The charged amino acids positioned in the amino terminus (M1 and D2) and first extracellular loop (E42) have been identified as major determinants of the current-voltage relation of Gjb1 channels . These molecular determinants should be considered when designing mutations for structure-function studies.

How can recombinant mouse Gjb1 be used to model Charcot-Marie-Tooth disease?

Recombinant mouse Gjb1 provides a valuable tool for modeling Charcot-Marie-Tooth disease (CMTX1) through several approaches:

In Vitro Disease Modeling:

  • Introduce disease-causing mutations identified in human patients into mouse Gjb1 through site-directed mutagenesis

  • Express wild-type and mutant proteins in cell systems to assess:

    • Protein trafficking and localization

    • Gap junction plaque formation

    • Channel functionality using dye transfer and electrophysiology

    • Interactions with partner proteins

Functional Characterization:
Clinical studies have identified numerous GJB1 variants in patients with CMTX1, with 154 different variants reported across 387 patients in one large international study . These variants can be recreated in mouse Gjb1 to determine their functional consequences.

When studying these disease models, researchers should consider both loss-of-function mechanisms (reduced channel activity) and potential gain-of-function effects (altered selectivity or toxic effects of misfolded proteins).

What are the molecular mechanisms underlying Gjb1-associated demyelination in peripheral neuropathy?

The molecular mechanisms underlying Gjb1-associated demyelination involve several interconnected pathways:

  • Disrupted Schwann cell homeostasis:

    • Gjb1 forms reflexive gap junctions between adjacent membrane layers in myelinating Schwann cells

    • Loss of functional Gjb1 disrupts the diffusion of ions and small molecules across myelin layers

    • This leads to impaired metabolic support for the myelination process

  • Altered protein trafficking and ER stress:

    • Mutant Gjb1 proteins may be retained in the endoplasmic reticulum, triggering the unfolded protein response

    • Accumulated misfolded proteins can activate apoptotic pathways in Schwann cells

  • Disrupted axon-glial signaling:

    • Gjb1 participates in communication between Schwann cells and axons

    • Disruption of this communication impairs coordinated responses to axonal signals

    • This can lead to progressive demyelination despite initially normal myelin formation

These mechanisms provide potential therapeutic targets for CMTX1, including approaches to enhance protein folding, reduce ER stress, or bypass the requirement for functional Gjb1 in myelin maintenance.

How do age-related changes in Gjb1 contribute to cochlear dysfunction?

Age-related changes in Gjb1 expression and function contribute significantly to cochlear dysfunction and age-related hearing loss:

Biochemical Alterations with Age:
Studies in C57BL/6J mice (a model of age-related hearing loss) have revealed that Gjb1 undergoes significant changes between 4 and 32 weeks of age:

  • Decreased protein expression levels

  • Conversion from hydrophilic to hydrophobic biochemical properties

  • Significant shortening of gap junction plaques along cell-cell junction sites

Importantly, these biochemical changes precede severe hair cell degeneration, suggesting that gap junction dysfunction may be an early event in age-related hearing loss. The hydrophobic conversion of Gjb1 may affect its ability to form functional gap junctions, disrupting the intercellular communication necessary for cochlear function.

Temporal Sequence of Events:

Age (weeks)Hearing FunctionGjb1 ChangesStructural Changes
4NormalLinear plaques along cell junctionsIntact hair cells
32Gradual declineShorter gap junctions, hydrophobic conversionMinimal hair cell loss
36Sharp declineSeverely disrupted gap junctionsProgressive hair cell degeneration

These findings suggest that interventions targeting Gjb1 stability and function might provide therapeutic opportunities for age-related hearing loss if implemented before irreversible structural damage occurs .

What genetic approaches can be used to study Gjb1 function and regulation?

Several genetic approaches have proven valuable for investigating Gjb1 function and regulation:

Gene Editing and Mutation Analysis:

  • CRISPR/Cas9-mediated modification of endogenous Gjb1

    • Introduction of patient-specific mutations

    • Fluorescent tagging for live-cell imaging

    • Conditional knockout systems

  • Haplotype analysis for complex genetic interactions

    • NGS-based SNP haplotyping has been used to track GJB1 mutations in family studies

    • This approach can help determine the inheritance patterns of Gjb1 variants

    • Particularly valuable for studying X-linked inheritance patterns (as Gjb1 is located on the X chromosome)

Transcriptional Regulation Studies:
Studies of human GJB1 suggest that expression may be regulated by MITF in melanocytic cells . Similar transcription factor dependencies may exist in mouse tissues and should be investigated to understand tissue-specific expression patterns.

How do post-translational modifications affect Gjb1 function and stability?

Post-translational modifications significantly impact Gjb1 function and stability:

Key Modification Types:

  • Phosphorylation: Affects channel gating, trafficking, and degradation

    • Primarily occurs on serine and tyrosine residues in the C-terminal domain

    • PKC-mediated phosphorylation can decrease channel conductance

    • Casein kinase 1-mediated phosphorylation may regulate trafficking

  • Ubiquitination: Controls protein turnover and quality control

    • K48-linked ubiquitination targets Gjb1 for proteasomal degradation

    • This process is enhanced for mutant forms that fail quality control

  • Acetylation: May influence protein-protein interactions

    • Targets lysine residues primarily in the C-terminal domain

    • Can compete with ubiquitination to stabilize the protein

When studying these modifications, researchers should consider using phosphatase inhibitors during protein extraction and specialized antibodies that recognize specific modifications. Mass spectrometry-based approaches can provide a comprehensive view of the modification landscape in different physiological and pathological conditions.

What advanced imaging techniques are most informative for studying Gjb1 trafficking and assembly?

Several cutting-edge imaging approaches provide valuable insights into Gjb1 trafficking and assembly:

Super-Resolution Microscopy:

  • Stimulated Emission Depletion (STED) Microscopy

    • Achieves resolution below the diffraction limit (~50 nm)

    • Ideal for visualizing individual gap junction plaques and connexons

    • Can be combined with live-cell imaging for dynamic studies

  • Single-Molecule Localization Microscopy (PALM/STORM)

    • Provides nanometer-scale resolution of protein organization

    • Useful for quantifying connexon density and distribution

    • Can reveal substructure within gap junction plaques

Live-Cell Imaging Applications:

  • Fluorescence Recovery After Photobleaching (FRAP)

    • Measures lateral mobility of Gjb1 within the membrane

    • Quantifies exchange rates between junctional and non-junctional pools

    • Helps determine the stability of gap junction plaques

  • Förster Resonance Energy Transfer (FRET)

    • Detects protein-protein interactions at nanometer scale

    • Useful for studying Gjb1 interactions with other connexins or regulatory proteins

    • Can be combined with fluorescence lifetime imaging for quantitative analysis

When conducting these studies, fluorescent protein tags or specific antibody labeling can be used, though researchers should verify that tagging does not interfere with protein function or trafficking. For studying the role of charged amino acids in channel function, combining imaging with electrophysiological recordings provides the most comprehensive understanding of structure-function relationships .

How can systems biology approaches enhance our understanding of Gjb1 function in complex tissues?

Systems biology offers powerful frameworks for integrating diverse data types to understand Gjb1 function:

Multi-omics Integration:

  • Combine transcriptomics, proteomics, and metabolomics data from Gjb1-deficient models

  • Identify compensatory mechanisms activated in response to Gjb1 dysfunction

  • Map the network of proteins that interact with Gjb1 under different conditions

  • Develop predictive models of gap junction function in health and disease

Single-Cell Analysis:
Single-cell RNA sequencing of tissues with heterogeneous Gjb1 expression can reveal:

  • Cell type-specific expression patterns

  • Transcriptional responses to Gjb1 dysfunction

  • Identification of vulnerable cell populations in disease states

  • Potential cell-autonomous and non-cell-autonomous effects

When implementing these approaches, researchers should consider the X-linked nature of Gjb1, which can lead to mosaicism in female animals due to random X-inactivation. This creates natural heterogeneity that can be leveraged for single-cell studies of Gjb1 function.

What therapeutic approaches targeting Gjb1 show promise for connexin-related diseases?

Several emerging therapeutic approaches targeting Gjb1 show potential for treating connexin-related diseases:

Gene Therapy Approaches:

  • AAV-mediated gene delivery

    • Can restore wild-type Gjb1 expression in Schwann cells

    • Shows promise in preclinical models of CMTX1

    • Challenges include targeting specificity and long-term expression

  • Antisense oligonucleotides (ASOs)

    • Can target specific mutant alleles for knockdown

    • Particularly promising for dominant-negative mutations

    • Could be used to correct splicing defects in 5'UTR mutations

Small Molecule Interventions:

  • Protein folding modulators

    • Chemical chaperones that assist in proper folding of mutant Gjb1

    • May rescue trafficking defects for certain mutations

    • Examples include sodium 4-phenylbutyrate and trimethylamine N-oxide

  • Gap junction modulators

    • Compounds that can enhance or stabilize remaining gap junction function

    • May be beneficial in cases with reduced but not absent channel function

    • Could potentially address age-related changes in gap junction proteins

When developing these approaches, researchers should consider the tissue-specific expression patterns of Gjb1 and the potential for compensatory mechanisms through other connexin family members.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.