Recombinant Mouse Gap junction beta-3 protein (Gjb3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please include them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of the protein is dependent on various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us and we will prioritize its inclusion during production.
Synonyms
Gjb3; Cxn-31; Gap junction beta-3 protein; Connexin-31; Cx31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Gjb3
Target Protein Sequence
MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTRQPGC TNVCYDNFFPISNIRLWALQLIFVTCPSMLVILHVAYREERERKHRQKHGEQCAKLYSHP GKKHGGLWWTYLFSLIFKLIIELVFLYVLHTLWHGFTMPRLVQCASIVPCPNTVDCYIAR PTEKKVFTYFMVGASAVCIILTICEICYLIFHRIMRGISKGKSTKSISSPKSSSRASTCR CHHKLLESGDPEADPASEKLQASAPSLTPI
Uniprot No.

Target Background

Function
Gap junctions are comprised of clusters of closely packed pairs of transmembrane channels, known as connexons. These channels facilitate the diffusion of low molecular weight materials between adjacent cells.
Gene References Into Functions
  1. Connexin 31-deficient trophoblast stem cells exhibited a shift in giant cell differentiation from Prl3d1 expressing parietal giant cells to Ctsq, Prl3b1, and Prl2c2-positive giant cells. PMID: 22623621
  2. Expression of Connexin 31 is regulated by distinct mechanisms in embryonic stem cells and keratinocytes. PMID: 11827454
  3. Expression profile of Gjb3 in the developing mouse cochlea PMID: 12617848
  4. Mutant Cx31 displayed reduced phosphorylation levels compared to wild-type Cx31, indicating a critical role of serine residue 266 in Cx31 phosphorylation. However, this mutation did not interfere with the proper intracellular trafficking of gap junction proteins. PMID: 15023533
  5. During trophoblast cell lineage differentiation, the Cx31 gap junction channel plays a role in maintaining the proliferative diploid trophoblast cell population. PMID: 15302598
  6. Cx31 and Cx43 proteins functionally interact, potentially forming heteromeric channels in the epidermis. PMID: 17446259

Show More

Hide All

Database Links
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is the molecular structure of mouse Gjb3 and how does it differ from human GJB3?

Mouse Gjb3 is a connexin protein with a calculated molecular weight of approximately 30.8 kDa . Like other connexins, it consists of four transmembrane domains, two extracellular loops, one cytoplasmic loop, and cytoplasmic N-terminal and C-terminal regions. While mouse Gjb3 shares high sequence homology with human GJB3 (approximately 85-90% amino acid identity), there are notable differences in the C-terminal domain that may affect protein-protein interactions and regulatory phosphorylation sites. These structural differences should be considered when using mouse models to study human gap junction-related diseases.

For functional studies, researchers should be aware that recombinant Gjb3 may form heteromeric connexons with other connexin proteins when expressed in cells already expressing endogenous connexins.

What are the recommended expression systems for producing functional recombinant mouse Gjb3?

For producing biologically active recombinant mouse Gjb3, mammalian expression systems are generally preferred over bacterial systems due to the requirement for proper post-translational modifications and membrane integration. The following approaches have demonstrated success:

  • HEK293 cell expression system: Using vectors with strong promoters (CMV, EF1α) yields moderate to high expression with proper trafficking.

  • Baculovirus-insect cell system: Provides higher yields while maintaining proper folding, though with slightly different glycosylation patterns.

  • Cell-free membrane protein expression systems: Allow controlled incorporation into artificial lipid environments.

To confirm proper expression and functional activity, researchers should perform:

  • Western blotting with validated anti-Gjb3 antibodies

  • Immunofluorescence to verify membrane localization

  • Dye transfer assays to confirm gap junction functionality

How can I verify the functionality of recombinant mouse Gjb3 in experimental models?

Functional validation of recombinant Gjb3 is critical and should include multiple complementary approaches:

Dye Transfer Assays:

  • Scrape loading with Lucifer Yellow (molecular weight 457 Da) to assess gap junction-mediated intercellular communication

  • Microinjection of fluorescent tracers of different molecular weights to determine channel permeability characteristics

Electrophysiological Assessment:

  • Dual whole-cell patch clamp recordings to measure junctional conductance

  • Single channel recordings to assess conductance states and gating properties

Metabolite Transfer Assays:

  • Radioactive amino acid transfer between coupled cells (particularly relevant given Gjb3's role in cystine uptake)

  • Calcium imaging to evaluate intercellular calcium wave propagation

Researchers should consider that GJB3 knockdown has been shown to induce cellular stress response pathways, including activation of starvation and autophagy pathways , which can serve as indirect functional readouts.

What methodologies are most effective for studying the role of Gjb3 in cellular stress responses and autophagy?

Recent research has revealed that GJB3 knockdown induces cellular stress responses characterized by activation of autophagy pathways . To investigate this relationship, the following methodological approaches are recommended:

For autophagy assessment:

  • Monitor LC3-II/LC3-I ratio and p62 levels via Western blot following Gjb3 modulation

  • Assess autophagy flux using tandem fluorescent-tagged LC3 (GFP-RFP-LC3) reporters

  • Measure the GFP-LC3 to RFP-LC3ΔG ratio to quantify autophagosome formation

For stress response pathway analysis:

  • Evaluate phosphorylation of eIF2α and expression of ATF4 via Western blot

  • Assess AMPK activation through phospho-AMPK detection

  • Implement RNA-seq analysis to identify differentially expressed genes in stress response pathways

For mechanistic studies:

  • Employ small molecule inhibitors of autophagy (3-MA) or siRNA targeting autophagy genes (ATG5) to determine if autophagy inhibition rescues proliferation defects observed with Gjb3 knockdown

  • Perform metabolic profiling to identify changes in amino acid levels, particularly cystine, in response to Gjb3 modulation

How can researchers effectively study the crosstalk between Gjb3 and other connexins in complex cellular systems?

Investigating connexin crosstalk requires sophisticated approaches to distinguish between homomeric and heteromeric gap junction channels:

Co-immunoprecipitation strategies:

  • Use epitope-tagged Gjb3 constructs (FLAG, HA, etc.) to pull down protein complexes

  • Employ mass spectrometry to identify connexin binding partners

  • Validate interactions with proximity ligation assays (PLA) to confirm in situ protein-protein associations

Advanced imaging techniques:

  • Implement super-resolution microscopy (STORM, PALM) to visualize gap junction plaque composition at nanoscale resolution

  • Use FRET (Förster Resonance Energy Transfer) to detect direct molecular interactions between different connexin subtypes

  • Apply correlative light and electron microscopy to associate functional data with ultrastructural details

Functional discrimination:

  • Design connexin-specific mimetic peptides to selectively block Gjb3 channels

  • Create cell lines with CRISPR/Cas9-mediated knockout of endogenous connexins to study recombinant Gjb3 in isolation

  • Employ electrophysiological recordings with distinctive channel conductances to identify contribution of specific connexin combinations

What are the most reliable approaches for studying Gjb3's role in cancer progression and therapeutic targeting?

Based on recent findings highlighting GJB3 overexpression in colorectal and lung cancers with significant impacts on patient outcomes , the following methodological approaches are recommended:

For expression and correlation studies:

  • Analyze TCGA data for GJB3 expression across cancer types and correlation with patient survival

  • Perform immunohistochemistry on tissue microarrays with validated anti-GJB3 antibodies

  • Create tissue-specific Gjb3 transgenic mouse models to study cancer development in vivo

For functional characterization:

  • Implement stable knockdown and overexpression systems using lentiviral vectors

  • Assess changes in proliferation using multiple complementary assays (EdU incorporation, colony formation, CCK8)

  • Evaluate migration capacity through transwell assays and wound healing experiments

For therapeutic targeting approaches:

  • Develop and validate specific antibodies against extracellular domains of Gjb3

  • Screen for small molecule inhibitors that disrupt Gjb3 channel function

  • Investigate combination approaches with demethylating agents, as GJB3 expression has been shown to affect response to such treatments

ApproachAdvantagesLimitationsKey Controls
Antibody targetingSpecificity for extracellular epitopesPotential cross-reactivityPre-absorption with immunizing peptide
siRNA/shRNATemporal control, efficient knockdownOff-target effectsMultiple target sequences, rescue experiments
CRISPR/Cas9Complete knockout, precise editingCompensatory mechanismsMultiple guide RNAs, off-target analysis

What are the critical factors affecting the solubility and stability of recombinant mouse Gjb3 protein?

Membrane proteins like Gjb3 present significant challenges for recombinant expression and purification. Key considerations include:

Buffer optimization:

  • Include mild detergents (0.5-1% DDM, CHAPS, or Triton X-100) for initial solubilization

  • Transition to amphipols or nanodiscs for long-term stability

  • Maintain pH between 7.0-7.5 to prevent aggregation

Storage considerations:

  • Store at -80°C with 10-20% glycerol to prevent freeze-thaw damage

  • Avoid repeated freeze-thaw cycles as noted in antibody storage guidelines

  • For short-term storage, maintain at 4°C with protease inhibitors

Refolding strategies:

  • Use stepwise dialysis to remove denaturing agents

  • Implement on-column refolding during purification

  • Consider lipid reconstitution immediately following purification

Researchers should validate protein integrity through circular dichroism spectroscopy and functional assays before experimental use.

How can I differentiate between the effects of monomeric Gjb3 proteins and gap junction channel formation in my experiments?

Distinguishing between non-junctional and junctional functions of Gjb3 requires careful experimental design:

Strategies to isolate monomeric functions:

  • Generate trafficking-deficient mutants that reach the membrane but fail to dock

  • Use connexin-mimetic peptides targeting extracellular loops to prevent docking

  • Implement low-density cultures to minimize cell-cell contact

Methods to confirm channel formation:

  • Electron microscopy to visualize gap junction plaques

  • Freeze-fracture analysis to assess plaque size and density

  • FRAP (Fluorescence Recovery After Photobleaching) to demonstrate channel-mediated dye transfer

Control experiments:

  • Express well-characterized dominant-negative Gjb3 mutants

  • Use gap junction blockers (carbenoxolone, 18-alpha-glycyrrhetinic acid) at appropriate concentrations

  • Implement calcium-free conditions to functionally uncouple gap junctions temporarily

What methodological approaches address the challenges in studying Gjb3's role in amino acid transport, particularly cystine uptake?

Recent research has identified GJB3's critical role in cystine uptake, especially in cells with low SLC7A11 expression . To study this function:

Uptake assays:

  • Use radiolabeled cystine (35S-cystine) for direct measurement of transport kinetics

  • Implement competitive inhibition assays with structurally similar amino acids

  • Monitor intracellular glutathione levels as an indirect measure of cystine uptake and utilization

Molecular approaches:

  • Generate point mutations in putative pore-lining residues to identify critical amino acids for transport

  • Co-express Gjb3 with SLC7A11 at varying ratios to study potential cooperative effects

  • Use proximity labeling techniques (BioID, APEX) to identify proteins associating with Gjb3 in the context of amino acid transport

Metabolic analysis:

  • Perform targeted metabolomics to profile changes in amino acid pools following Gjb3 modulation

  • Implement stable isotope tracing to track metabolic fate of transported cystine

  • Assess changes in redox status in response to altered cystine uptake

How should researchers interpret conflicting data regarding Gjb3 function across different tissue types?

Gap junction proteins like Gjb3 often display tissue-specific functions. When encountering conflicting data:

Analytical approach:

  • Consider cell type-specific connexin expression profiles that may influence Gjb3 function

  • Evaluate post-translational modifications that differ between tissues

  • Assess different methodological approaches that may yield seemingly contradictory results

Reconciliation strategies:

  • Perform side-by-side comparisons under identical experimental conditions

  • Use multiple cell lines representative of different tissues

  • Implement in vivo models with tissue-specific knockout/expression

Contextual considerations:

  • Examine microenvironmental factors that may modify Gjb3 function

  • Consider developmental stage-specific functions

  • Evaluate pathological contexts that may alter normal function

What are the key considerations when designing experiments to study the epigenetic regulation of Gjb3?

Research has shown that GJB3 expression is regulated by DNA methylation in various cancer types . When designing studies to investigate epigenetic regulation:

Methodological approaches:

  • Perform bisulfite sequencing of the Gjb3 promoter region to identify specific methylation patterns

  • Use chromatin immunoprecipitation (ChIP) to identify histone modifications and transcription factor binding

  • Implement ATAC-seq to assess chromatin accessibility around the Gjb3 locus

Treatment strategies:

  • Apply demethylating agents (5-aza-2'-deoxycytidine/DAC) at optimized concentrations (e.g., 2.5μM)

  • Use histone deacetylase inhibitors to study histone modification effects

  • Implement targeted epigenome editing using CRISPR-dCas9 systems fused to epigenetic modifiers

Data analysis considerations:

  • Correlate methylation patterns with expression levels across multiple cell types

  • Consider potential enhancer regions beyond the proximal promoter

  • Integrate multi-omics data to understand regulatory networks

How can Gjb3 research contribute to understanding cellular response to stress and potential therapeutic applications?

The role of GJB3 in cellular stress responses and survival mechanisms presents opportunities for therapeutic development:

Translational research approaches:

  • Study Gjb3 modulation in combination with conventional cancer therapies to identify synergistic effects

  • Investigate the relationship between Gjb3 and the GCN2-eIF2α-ATF4 signaling axis in various stress conditions

  • Develop targeted therapies based on Gjb3's role in cystine uptake for cancers with metabolic vulnerabilities

Therapeutic potential assessment:

  • Screen for small molecules that selectively modulate Gjb3 function

  • Evaluate antibody-based approaches targeting Gjb3 extracellular domains

  • Investigate mRNA-based therapeutics for transient modulation of Gjb3 expression

Clinical correlation studies:

  • Analyze patient-derived samples for Gjb3 expression in relation to treatment response

  • Develop predictive biomarkers based on Gjb3 expression patterns

  • Stratify patients based on Gjb3-related molecular signatures for personalized medicine approaches

What emerging technologies will advance our understanding of Gjb3 function in intercellular communication?

Several cutting-edge approaches show promise for Gjb3 research:

Advanced imaging technologies:

  • Implement lattice light-sheet microscopy for real-time visualization of gap junction dynamics

  • Use expansion microscopy to resolve gap junction plaque substructure

  • Apply cryo-electron tomography to study native gap junction architecture

Single-cell approaches:

  • Perform single-cell transcriptomics to identify cell populations with distinctive Gjb3 expression patterns

  • Use patch-seq to correlate electrophysiological properties with transcriptomic profiles

  • Implement spatial transcriptomics to map Gjb3 expression within tissue microenvironments

Optogenetic and chemogenetic tools:

  • Develop light-controlled Gjb3 variants for precise temporal modulation of channel activity

  • Create synthetic biology circuits to control Gjb3 expression in specific cellular contexts

  • Design chemically modified connexins for selective pharmacological targeting

How should researchers design experiments to study the interplay between Gjb3 and immune system components?

Recent studies have explored connections between GJB3 and immune infiltration in cancer contexts . To investigate this relationship:

Experimental design considerations:

  • Use co-culture systems with immune cells and Gjb3-expressing cells

  • Implement CIBERSORT or TIMER algorithms to analyze immune cell infiltration patterns in relation to Gjb3 expression

  • Develop syngeneic mouse models with modulated Gjb3 expression to study immune responses in vivo

Functional assessment approaches:

  • Measure cytokine production and release in response to Gjb3 modulation

  • Analyze immune checkpoint molecule expression in Gjb3-high versus Gjb3-low conditions

  • Assess T-cell activation and proliferation in co-culture with Gjb3-modulated cancer cells

Mechanistic investigations:

  • Study hemichannel-mediated release of immunomodulatory molecules

  • Investigate direct gap junction coupling between immune and target cells

  • Explore the role of Gjb3 in antigen presentation and recognition processes

What comprehensive approaches should be used to study Gjb3's role across multiple disease models?

To fully understand Gjb3's diverse functions in different pathological contexts:

Integrated model systems:

  • Develop conditional Gjb3 knockout mice for tissue-specific and temporal control

  • Create patient-derived organoids to study Gjb3 in disease-relevant microenvironments

  • Implement CRISPR screens to identify synthetic lethal interactions with Gjb3 in disease models

Multi-omics integration:

  • Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models of Gjb3 function

  • Use systems biology approaches to identify disease-specific Gjb3 interaction networks

  • Apply machine learning algorithms to predict context-dependent Gjb3 functions

Translational approaches:

  • Analyze clinical biobanks to correlate Gjb3 expression with disease progression and treatment outcomes

  • Perform drug repurposing screens to identify approved compounds that modulate Gjb3 function

  • Develop companion diagnostics for Gjb3-targeted therapies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.