Recombinant Mouse Gap junction beta-4 protein (Gjb4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Gjb4

Recombinant Mouse Gap Junction Beta-4 Protein (Gjb4), encoded by the GJB4 gene, is a transmembrane connexin protein (Cx30.3) that forms gap junctions critical for intercellular communication . While primarily studied in human contexts (e.g., hypertrophic cardiomyopathy and skin disorders), recombinant mouse Gjb4 is increasingly used in preclinical research to model cardiac and epidermal pathologies .

Production and Applications of Recombinant Gjb4

Recombinant mouse Gjb4 is commercially available in diverse formats:

Host SystemTags/ModificationsApplicationsSource
E. coliGST, HisStructural studies
MammalianFLAG, DDKFunctional assays
Wheat GermNon-taggedAntibody production

Experimental Uses:

  • Cardiac models: Studying gap junction remodeling in hypertrophy .

  • Epidermal models: Investigating trafficking defects in skin disorders .

  • Drug development: Screening for modulators of Gjb4-GJA1 interactions .

Hypertrophic Cardiomyopathy (HCM)

  • Human HCM: Homozygous GJB4 E204A mutation causes severe HCM by disrupting GJA1 binding .

  • Mouse models: Gjb4 upregulation observed in adriamycin-induced cardiomyopathy and myocardial infarction .

  • iPSC-derived cardiomyocytes: Abnormal Gjb4 colocalization with GJA1 correlates with arrhythmogenic phenotypes .

Skin Disorders

  • Erythrokeratodermia variabilis: Mutant Gjb4 (e.g., G12D, T85P) causes ER retention and epidermal dysfunction .

  • Trafficking defects: Mouse keratinocyte models show impaired surface expression of mutant Gjb4 .

Zebrafish Knockout Models

  • Gjb4 deficiency: Leads to systolic dysfunction and dyskinetic ventricular motion .

  • Functional role: Suggests Gjb4 is essential for maintaining cardiac structural integrity .

Comparative Analysis of Gjb4 Across Species

SpeciesDisease ModelKey Findings
HumanHCM, EKVPE204A impairs GJA1 binding; ER stress in skin
MouseAdriamycin cardiomyopathyGjb4 upregulation in hypertrophied ventricles
ZebrafishCRISPR knockoutReduced ejection fraction, dyskinetic motion
RatHypertension modelsGjb4 colocalizes with GJA1 in intercalated discs

Future Directions and Challenges

  • Therapeutic targeting: Enhancing Gjb4-GJA1 complex stability in HCM .

  • Trafficking rescue: Chemical chaperones or wild-type connexin co-expression to restore mutant Gjb4 function .

  • Species-specific roles: Limited data on mouse Gjb4’s physiological vs. pathological functions necessitate further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gjb4; Cxn-30.3; Gap junction beta-4 protein; Connexin-30.3; Cx30.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Gjb4
Target Protein Sequence
MNWGFLQGILSGVNKYSTALGRIWLSVVFIFRVLVYVVAAEEVWDDDQKDFICNTKQPGC PNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHRLKHGPNAPALYSNL SKKRGGLWWTYLLSLIFKAAVDSGFLYIFHCIYKDYDMPRVVACSVTPCPHTVDCYIARP TEKKVFTYFMVVTAAICILLNLSEVVYLVGKRCMEVFRPRRRKASRRHQLPDTCPPYVIS KGGHPQDESVILTKAGMATVDAGVYP
Uniprot No.

Target Background

Function

Connexin30.3 (Cx30.3) is a structural component of gap junctions, which are dodecameric channels connecting the cytoplasm of adjacent cells. These channels form through the docking of two hexameric hemichannels, one from each cell membrane. Small molecules and ions diffuse between cells via the central pore of these junctions.

Gene References Into Functions
  1. Studies suggest Cx30.3 involvement in the rapid formation and/or decomposition of gap junctions, potentially acting as a functional relay between Cx30.3 and other systems, such as adhesion proteins. PMID: 28205646
  2. Cx30 regulates cell adhesion and migration. Its modulation of glutamate transport is independent of its channel function and is mediated by morphological changes that control the insertion of astroglial processes into synaptic clefts. PMID: 24584052
  3. Connexin30.3-deficient mice show reduced behavioral responses to vanilla scent. PMID: 17728008
  4. Cx30.3 appears to be constitutively expressed in certain renal tubular segments and cells. PMID: 18649192
Database Links
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Detected in cochlea (at protein level). Detected in cochlea. Expressed in skin.

Q&A

What is Gap junction beta-4 protein (Gjb4) and what is its function in cellular communication?

Gap junction beta-4 protein (Gjb4) encodes a transmembrane connexin protein (Cx30.3) that is a component of gap junctions . Gap junctions are specialized intercellular connections that directly connect the cytoplasm of adjacent cells, allowing various molecules and ions to pass freely between cells. This protein plays a critical role in maintaining tissue homeostasis through coordinated cellular activities.

In research contexts, Gjb4 has been shown to play an important role in cardiac function across multiple species including humans, rodents, and zebrafish . Unlike some other connexins, GJB4 shows a unique expression pattern in that it appears to be primarily expressed in diseased cardiac tissue but not in normal hearts . This makes it particularly interesting for studies focusing on cardiac pathologies.

The methodological approach to studying Gjb4 function typically involves:

  • Immunohistochemistry to detect protein expression and localization

  • Co-immunoprecipitation to identify binding partners

  • Knockout models to observe phenotypic changes

  • Electrophysiological studies to measure gap junction communication

How does mouse Gjb4 compare structurally and functionally to human GJB4?

Mouse Gjb4 and human GJB4 share significant homology in their protein structure and function. Both encode connexin proteins that form hexameric structures called connexons, which dock with connexons from adjacent cells to form gap junction channels.

The human GJB4 protein consists of 266 amino acids and has a molecular mass of approximately 30.3 kDa . The full amino acid sequence of human GJB4 reveals the typical connexin structure with four transmembrane domains, two extracellular loops, and cytoplasmic N-terminal and C-terminal domains .

Functionally, both mouse Gjb4 and human GJB4 appear to be upregulated in certain pathological conditions. For instance, GJB4 expression is induced in various cardiac disease models, including left and right ventricle hypertrophy, adriamycin-induced cardiomyopathy, and myocardial infarction . This suggests conserved regulatory mechanisms and function across species.

When designing cross-species studies, researchers should note that while the proteins share significant homology, species-specific differences may exist in:

  • Tissue expression patterns

  • Regulatory mechanisms

  • Protein-protein interactions

  • Response to pharmacological agents

What are the common experimental applications for recombinant Gjb4 protein?

Recombinant Gjb4 protein serves multiple experimental applications in research settings:

  • Antibody Production: Recombinant Gjb4 is used as an antigen to generate specific antibodies for detection in various assays .

  • Western Blot Analysis: Purified recombinant protein serves as a positive control or for antibody validation in Western blot assays .

  • Enzyme-linked Immunosorbent Assay (ELISA): Quantitative measurement of Gjb4 in biological samples using recombinant protein as standards .

  • Protein-Protein Interaction Studies: Identifying binding partners through pull-down assays, co-immunoprecipitation, or yeast two-hybrid screening.

  • Protein Array Applications: High-throughput screening of protein interactions or antibody specificity .

  • Structural Analysis: X-ray crystallography or NMR studies to determine three-dimensional structure.

  • Functional Assays: Investigating channel properties in reconstituted systems.

For optimal results, the recombinant protein should be used within three months from the date of receipt and stored at -80°C with proper aliquoting to avoid repeated freezing and thawing cycles .

How is Gjb4 expression regulated in normal versus pathological cardiac conditions?

Gjb4 exhibits a remarkable expression pattern distinction between normal and pathological cardiac conditions:

Normal Cardiac Tissue:
In normal cardiac tissue, Gjb4 expression is typically absent or present at very low levels that are difficult to detect through standard immunohistochemical methods . This has been observed in both human and rodent studies, suggesting that Gjb4 is not required for normal cardiac function.

Pathological Cardiac Conditions:
Gjb4 expression is significantly induced in various cardiac disease models and clinical pathologies:

  • Hypertrophic Cardiomyopathy (HCM): GJB4 is expressed and colocalized with GJA1 (Connexin 43) at intercalated discs in human dilated HCM hearts .

  • Hypertensive Hearts: Similar upregulation and colocalization patterns are observed in hypertensive heart conditions .

  • Experimental Disease Models: Expression is induced in rat models of left and right ventricle hypertrophy and mouse models of adriamycin-induced cardiomyopathy and myocardial infarction .

The regulatory mechanisms behind this differential expression remain partially understood, but likely involve:

  • Transcriptional regulation through cardiac stress-responsive elements

  • Epigenetic modifications in disease states

  • Post-transcriptional regulation via microRNAs

  • Altered protein stability in pathological conditions

This disease-specific expression pattern makes Gjb4 an interesting potential biomarker and therapeutic target for cardiac pathologies.

What experimental approaches can be used to study the interaction between Gjb4 and other connexins?

Several experimental approaches can be employed to study interactions between Gjb4 and other connexins, particularly GJA1 (Connexin 43) with which it has been shown to colocalize:

Co-immunoprecipitation (Co-IP):

  • Pull down Gjb4 using specific antibodies and analyze co-precipitated proteins

  • Reciprocal Co-IP can confirm interactions

  • Quantification of binding under different conditions can reveal regulatory mechanisms

  • Example: GJB4-E204A mutation was shown to impair binding with GJA1 compared to wild-type GJB4

Proximity Ligation Assay (PLA):

  • Allows visualization of protein interactions in situ with subcellular resolution

  • Particularly useful for membrane proteins like connexins

  • Can be quantified to measure interaction strength

Förster Resonance Energy Transfer (FRET):

  • Tag connexins with appropriate fluorophore pairs

  • Measure energy transfer as indication of protein proximity

  • Live-cell imaging can reveal dynamic aspects of interactions

Bimolecular Fluorescence Complementation (BiFC):

  • Split fluorescent protein fragments are fused to potential interacting proteins

  • Reconstitution of fluorescence indicates interaction

  • Allows visualization of interaction in living cells

Expression Studies:

  • Immunohistochemistry for colocalization analysis

  • Double-labeling with markers for intercalated discs

  • Research has shown linear colocalization of GJA1 and GJB4 in diseased hearts

Functional Coupling Studies:

  • Dye transfer assays to measure gap junction communication

  • Electrophysiological measurements of gap junction conductance

  • Comparing homotypic versus heterotypic channels

When interpreting results, researchers should consider that:

  • Connexins can form both homotypic and heterotypic channels

  • Interactions may be tissue-specific or condition-dependent

  • Localization patterns (e.g., lateralization as observed with GJA1 but not GJB4 ) may provide functional insights

What are the challenges and solutions in producing functional recombinant Gjb4 protein?

Producing functional recombinant Gjb4 protein presents several challenges due to its transmembrane nature and complex structure. Here are the key challenges and potential solutions:

Challenges:

  • Transmembrane Protein Expression:

    • Connexins contain four transmembrane domains making heterologous expression difficult

    • Hydrophobic regions can cause protein aggregation

    • Proper folding is challenging in conventional expression systems

  • Post-translational Modifications:

    • Connexins undergo various post-translational modifications essential for function

    • Glycosylation patterns may differ between expression systems

  • Oligomerization:

    • Connexins naturally form hexamers (connexons)

    • Ensuring proper oligomerization is crucial for functional studies

  • Solubility Issues:

    • Membrane proteins are often insoluble without detergents

    • Finding conditions that maintain structure while solubilizing is difficult

Solutions and Methodological Approaches:

  • Expression Systems:

    • Wheat germ cell-free systems have been successfully used for human GJB4 expression

    • Insect cells (Sf9, High Five) often provide better folding for membrane proteins

    • Mammalian expression systems may better maintain native conformation

  • Fusion Tags:

    • GST tags can improve solubility and facilitate purification

    • His tags allow for metal affinity chromatography

    • Consider tag position (N-terminal preferred for connexins) and cleavage options

  • Detergent Screening:

    • Systematic screening of detergents for extraction and purification

    • Use of mild detergents like DDM, LMNG, or digitonin

    • Detergent exchange during purification

  • Quality Control Measures:

    • Size exclusion chromatography to verify oligomeric state

    • Circular dichroism to confirm secondary structure

    • Functional assays in reconstituted systems

  • Storage Considerations:

    • Store at -80°C in appropriate buffer (e.g., 50 mM Tris-HCl, pH 8.0 with 10 mM reduced Glutathione)

    • Aliquot to avoid repeated freeze-thaw cycles

    • Use within three months for optimal activity

When working with recombinant Gjb4, researchers should validate the protein's functional state through structural and functional assays before proceeding to experimental applications.

How can CRISPR/Cas9 technology be optimized for generating Gjb4 knockout mouse models?

CRISPR/Cas9 technology offers significant advantages for generating Gjb4 knockout mouse models with high efficiency and specificity. Here is a methodological approach to optimize this process:

Design Strategy:

  • gRNA Design:

    • Target early exons to ensure complete loss of function

    • Use multiple prediction algorithms to select gRNAs with high on-target and low off-target scores

    • For Gjb4, targeting conserved regions of the coding sequence can improve efficiency

    • Consider targeting regions encoding the first transmembrane domain for complete functional disruption

  • Delivery Method Optimization:

    • Pronuclear injection of Cas9 protein with gRNA (ribonucleoprotein complex) offers rapid action and reduced off-target effects

    • Electroporation can be used as an alternative to microinjection

    • Adeno-associated viral vectors can be used for somatic editing in adult mice

  • Verification and Validation:

    Verification MethodPurposeTimeline
    PCR & SequencingConfirm editing events2-3 days post-extraction
    Western blotVerify protein absence1-2 weeks
    RT-qPCRMeasure transcript levels1 week
    ImmunohistochemistryConfirm tissue-specific knockout1-2 weeks
  • Addressing Potential Challenges:

    • Design multiple gRNAs to increase chances of successful editing

    • Screen founders carefully for mosaicism

    • Backcross to ensure germline transmission

    • Consider conditional knockout strategies if complete knockout is lethal

  • Phenotypic Analysis:
    Based on existing research, particular attention should be paid to:

    • Cardiac function assessment (echocardiography) as GJB4 has been implicated in cardiac function

    • Heart structure evaluation (histopathology)

    • Endodiastolic volume and ventricular ejection fraction measurements (shown to be affected in zebrafish models)

    • Potential hearing impairment testing (as GJB4 variants have been associated with hearing impairment)

This approach has been validated in animal models, including zebrafish where GJB4 knockout resulted in significantly lower endodiastolic volume and ventricular ejection fraction compared to wild-type fish .

What methods should be used to investigate the role of Gjb4 in cardiac hypertrophy and dysfunction?

To comprehensively investigate the role of Gjb4 in cardiac hypertrophy and dysfunction, a multi-faceted approach incorporating various methods is recommended:

1. Animal Models and Genetic Approaches:

  • Gjb4 Knockout Models: Generate using CRISPR/Cas9 as described in previous questions

  • Transgenic Overexpression: Create cardiac-specific Gjb4 overexpression models to study gain-of-function effects

  • Point Mutation Models: Introduce specific mutations (e.g., E204A) that have been associated with human cardiomyopathy

  • Conditional Expression Systems: Use Cre-loxP or Tet-on/off systems for temporal control of expression

2. Cardiac Function Assessment:

  • Echocardiography: Measure left ventricular ejection fraction, fractional shortening, and chamber dimensions

  • Hemodynamic Measurements: Catheter-based pressure-volume relationships

  • Electrocardiography (ECG): Assess electrical conduction abnormalities

  • Langendorff Perfused Heart: Evaluate ex vivo cardiac function

3. Molecular and Cellular Analyses:

  • Protein Expression and Localization:

    • Immunohistochemistry to examine Gjb4 expression patterns in normal vs. hypertrophic hearts

    • Co-staining with GJA1 to assess colocalization at intercalated discs

    • Western blotting for quantitative analysis

  • Mechanistic Studies:

    • Co-immunoprecipitation to study interactions with other proteins, particularly GJA1

    • RNA-seq for transcriptome analysis of Gjb4-deficient hearts

    • ChIP-seq to identify transcription factors regulating Gjb4 expression

    • Patch-clamp studies to assess gap junction function

4. Disease Model Induction:

Disease ModelInduction MethodExpected Gjb4 ResponseKey Measurements
Pressure OverloadTransverse aortic constriction (TAC)UpregulationHypertrophy, fibrosis, function
Volume OverloadAortocaval fistulaPotential upregulationChamber dilation, function
Ischemic InjuryCoronary artery ligationUpregulation in border zoneInfarct size, remodeling
Drug-inducedAdriamycin treatmentUpregulation Contractile dysfunction

5. Translational Approaches:

  • iPSC-Derived Cardiomyocytes: Generate from patients with GJB4 mutations

    • Assess beating patterns, calcium handling, and electrophysiological properties

    • Examine abnormal expression and localization of GJB4

  • Therapeutic Targeting:

    • Small molecule screening to identify modulators of Gjb4 function

    • Gene therapy approaches to normalize Gjb4 expression

This multi-dimensional approach will provide comprehensive insights into how Gjb4 contributes to cardiac hypertrophy and dysfunction, potentially identifying new therapeutic targets for heart disease.

How can researchers distinguish between the roles of Gjb4 and other connexins in tissue-specific studies?

Distinguishing between the roles of Gjb4 and other connexins in tissue-specific studies requires carefully designed experimental approaches that can isolate the specific contributions of each connexin. Here are methodological strategies to achieve this distinction:

1. Selective Genetic Manipulation:

  • Single and Combinatorial Knockouts: Generate single Gjb4 knockout models and compare with knockouts of other connexins (e.g., Gja1/Cx43)

  • Knock-in Models: Replace Gjb4 with other connexins under the same promoter to test functional substitution

  • Tissue-Specific Deletion: Use tissue-specific promoters to drive Cre recombinase expression for conditional deletion

  • Temporal Control: Employ inducible systems to examine acute versus chronic effects of connexin deletion

2. Expression Pattern Analysis:

  • High-Resolution Confocal Microscopy:

    • Use highly specific antibodies to differentiate between connexins

    • Apply spectral unmixing for multi-connexin labeling

    • Quantify colocalization coefficients

  • Single-Cell Transcriptomics:

    • Identify cell populations expressing unique connexin profiles

    • Track changes in connexin expression during disease progression

3. Functional Discrimination Techniques:

  • Gap-FRAP (Fluorescence Recovery After Photobleaching):

    • Measure dye transfer between cells

    • Compare transfer rates before and after selective connexin blockade

  • Electrophysiological Approaches:

    • Dual-cell patch clamp to measure gap junction conductance

    • Use connexin-specific peptide inhibitors or antibodies to block specific channels

    • Analyze unique channel properties (conductance, voltage sensitivity)

4. Disease Model-Specific Analysis:

Distinct expression patterns can help distinguish connexin roles. For example:

  • GJB4 is expressed in diseased hearts but not in normal hearts

  • GJA1 shows lateralization in some disease conditions while GJB4 does not

5. Protein-Protein Interaction Analysis:

  • Proximity Ligation Assay: Quantify specific interactions between connexins

  • FRET Analysis: Measure energy transfer between labeled connexins

  • Co-IP with Specific Antibodies: Pull down specific connexins and identify binding partners

6. Bioinformatic Analysis:

  • Promoter Analysis: Identify unique transcription factor binding sites

  • Evolutionary Conservation: Compare across species to identify unique vs. shared functions

  • Pathway Enrichment: Identify unique signaling pathways associated with each connexin

7. Practical Experimental Considerations:

Discrimination ApproachAdvantageLimitationBest Applied To
Genetic knockoutDefinitivePotential compensationDevelopmental studies
Mimetic peptidesAcute blockadeLimited specificityFunctional studies
RNAi approachesCell-type specificIncomplete knockdownIn vitro systems
Antibody blockadeIsoform specificLimited tissue penetrationEx vivo studies
Channel blockersRapid actionPoor selectivityElectrophysiology

By combining these methodological approaches, researchers can effectively dissect the specific contributions of Gjb4 versus other connexins in various physiological and pathological contexts.

What are the implications of Gjb4 research for understanding human GJB4-related disorders?

Research on mouse Gjb4 has significant implications for understanding human GJB4-related disorders, providing insights into molecular mechanisms, potential therapeutic targets, and disease modeling approaches:

1. Known Human GJB4-Associated Disorders:

  • Erythrokeratodermia Variabilis: Characterized by transient erythematous patches and fixed hyperkeratotic plaques

  • Progressive Symmetric Erythrokeratoderma: Featuring symmetric, fixed erythematous plaques with hyperkeratosis

  • Hearing Impairment: Non-syndromic hearing loss has been associated with GJB4 variants

  • Hypertrophic Cardiomyopathy: A familial form of HCM has been linked to GJB4 mutations

2. Molecular Insights from Mouse Models:

Mouse Gjb4 research provides crucial insights into how mutations affect protein function:

  • Protein Localization: Studies show that both normal localization and mislocalization patterns of Gjb4 contribute to disease phenotypes

  • Protein-Protein Interactions: Altered interactions with other connexins, particularly GJA1, may contribute to disease mechanisms

  • Tissue-Specific Expression: The differential expression of Gjb4 in normal versus diseased tissues helps explain tissue-specific manifestations

3. Translational Research Methodologies:

Research ApproachApplication to Human DiseaseKey Findings
Knock-in mutationsModel specific human mutationsE204A mutation impaired binding with GJA1
iPSC disease modelingPatient-specific cellular phenotypesAbnormal expression/localization in patient iPSC-CMs
Cross-species validationConservation of functionSimilar cardiac phenotypes in zebrafish, mice, humans
Genetic screeningIdentification of pathogenic variantsNovel variants like p.Asn119Thr in hearing impairment

4. Clinical Relevance and Therapeutic Implications:

  • Biomarker Potential: Gjb4 expression might serve as a biomarker for cardiac pathology

  • Drug Development Targets: Understanding protein interactions suggests potential therapeutic approaches

  • Genetic Counseling: Improved understanding of genotype-phenotype correlations aids in genetic counseling

  • Precision Medicine: Patient-specific models allow for personalized treatment approaches

5. Case Study Insights:

A particularly informative case involved a patient and her older brother who presented with severe hypertrophic cardiomyopathy, born to consanguineous parents. Exome analysis revealed a homozygous mutation in GJB4 (E204A) located in the 4th transmembrane domain. This mutation impaired binding with GJA1, suggesting a molecular mechanism for the observed cardiac dysfunction .

Understanding gained from mouse Gjb4 studies continues to inform our approach to human GJB4-related disorders, highlighting the importance of connexin biology in multiple organ systems and providing rational bases for therapeutic development.

How can recombinant Gjb4 be used in high-throughput screening for potential therapeutic compounds?

Recombinant Gjb4 protein can be effectively utilized in high-throughput screening (HTS) campaigns to identify potential therapeutic compounds targeting connexin-related disorders. Here's a comprehensive methodological approach:

1. Assay Development and Optimization:

  • Protein Production Considerations:

    • Express recombinant Gjb4 with appropriate tags (GST or His) for immobilization and detection

    • Ensure protein quality through SEC, Western blot, and functional verification

    • Optimize storage conditions (-80°C with aliquoting to avoid freeze-thaw cycles)

  • Binding Assay Formats:

    • Direct Binding Assays: Measure compound binding to immobilized Gjb4

    • Competition Assays: Displace labeled ligands or protein partners

    • FRET-Based Assays: Detect conformational changes upon compound binding

    • Alpha Screen: Detect protein-protein interactions and their modulation

2. Protein-Protein Interaction Screens:

Given that impaired GJB4-GJA1 interaction is implicated in disease , developing assays to rescue or modulate this interaction is valuable:

  • Target Interaction: GJB4-GJA1 (connexin 43) interaction

  • Assay Design:

    • Immobilize GST-tagged Gjb4 on glutathione plates

    • Add fluorescently labeled GJA1

    • Measure displacement or enhancement of interaction by compounds

  • Readout: Fluorescence polarization or FRET

3. Functional Screens:

  • Dye Transfer Assays:

    • Transfect cells with Gjb4 constructs (wild-type and disease mutants)

    • Load with gap junction-permeable dyes

    • Screen for compounds that modulate dye transfer

    • Automated microscopy for high-throughput imaging

  • Electrophysiological Screens:

    • Use automated patch-clamp systems

    • Measure gap junction conductance in Gjb4-expressing cells

    • Identify compounds that normalize mutant channel function

4. Compound Library Considerations:

Library TypeAdvantagesConsiderationsScale
FDA-approved drugsRapid repurposing potentialLimited chemical diversity1,000-5,000 compounds
Natural productsNovel scaffolds, good safetyComplex structures, supply issues10,000-50,000 extracts
Focused librariesHigher hit ratesMay miss novel mechanisms5,000-20,000 compounds
Diversity librariesBroad mechanism coverageLower hit rates100,000+ compounds

5. Validation Cascade:

  • Primary Screen: Medium to high-throughput binding or functional assay

  • Confirmation: Repeat hits in duplicate or triplicate

  • Dose-Response: Determine potency (EC50/IC50)

  • Selectivity: Test against other connexins to determine specificity

  • Cellular Validation: Assess in relevant cell models

    • iPSC-derived cardiomyocytes from patients with GJB4 mutations

    • Primary cells expressing Gjb4

  • Mechanism of Action: Determine how compounds affect Gjb4 function

  • In Vivo Validation: Test in relevant disease models

    • Gjb4 knockout or mutant mice

    • Zebrafish models with cardiac phenotypes

6. Specialized Approaches for Gjb4:

Since GJB4 is particularly expressed in disease conditions like cardiac hypertrophy , consider:

  • Screens in stressed cellular environments

  • Compounds that normalize disease-specific expression patterns

  • Modulators of Gjb4 trafficking to intercalated discs

This comprehensive approach to high-throughput screening utilizing recombinant Gjb4 offers a promising path to identifying therapeutic compounds for connexin-related disorders, particularly those affecting cardiac function.

What quality control measures are essential when working with recombinant Gjb4 protein?

Ensuring the quality and integrity of recombinant Gjb4 protein is crucial for obtaining reliable experimental results. Here are comprehensive quality control measures essential for researchers working with this protein:

1. Purity Assessment:

  • SDS-PAGE Analysis:

    • Run protein samples under reducing and non-reducing conditions

    • Expected molecular weight for GST-tagged human GJB4: ~55 kDa

    • Look for single band indicating high purity

  • High-Performance Liquid Chromatography (HPLC):

    • Size exclusion chromatography to assess homogeneity

    • Reverse-phase HPLC for purity quantification

    • Aim for >90% purity for most applications, >95% for structural studies

  • Mass Spectrometry:

    • Confirm molecular weight

    • Peptide mapping to verify sequence integrity

    • Identify any post-translational modifications

2. Functional Verification:

  • Binding Assays:

    • Verify interaction with known partners (e.g., GJA1)

    • Compare wild-type and mutant variants (e.g., E204A) for expected differences in binding

  • Structural Assessment:

    • Circular dichroism (CD) to verify secondary structure

    • Thermal shift assays to assess stability

    • Dynamic light scattering for aggregation assessment

  • Activity Tests:

    • For connexins, reconstitution into liposomes or other membrane mimetics

    • Dye transfer assays in reconstituted systems

3. Storage and Stability Testing:

  • Recommended Storage Conditions:

    • Store at -80°C in appropriate buffer (50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0)

    • Aliquot to avoid repeated freeze-thaw cycles

    • Use within three months for optimal activity

  • Stability Testing:

    • Accelerated stability studies at different temperatures

    • Freeze-thaw stability assessment

    • Long-term storage evaluation

4. Contamination Testing:

  • Endotoxin Testing:

    • LAL (Limulus Amebocyte Lysate) assay

    • Critical for applications involving cell culture or in vivo studies

    • Acceptable limits: <1 EU/μg protein for cell culture, <0.1 EU/μg for in vivo

  • Microbial Contamination:

    • Sterility testing if intended for cell culture

    • Filter sterilization before use in sterile applications

  • Host Cell Protein Analysis:

    • ELISA-based detection of residual host cell proteins

    • Particularly important for wheat germ-expressed proteins

5. Batch-to-Batch Consistency:

Quality ParameterAcceptance CriteriaMethodFrequency
Protein concentrationWithin 10% of specificationBCA or Bradford assayEvery batch
Purity>90%SDS-PAGE, HPLCEvery batch
IdentityMatches referenceWestern blot, MSEvery batch
Endotoxin<1 EU/μg proteinLAL assayEvery batch
Functional activity>80% of reference standardBinding assayEvery batch
Aggregation<10%SEC or DLSEvery batch

6. Documentation and Reporting:

  • Maintain detailed records of all QC tests

  • Include certificates of analysis with batches

  • Document storage conditions and freeze-thaw cycles

  • Track protein performance in downstream applications

Implementing these rigorous quality control measures will ensure that experiments using recombinant Gjb4 protein yield reproducible and reliable results, particularly in complex applications such as structural studies, functional assays, and high-throughput screening campaigns.

What are the best experimental design considerations when comparing wild-type and mutant Gjb4 proteins?

When designing experiments to compare wild-type and mutant Gjb4 proteins, careful consideration of several key factors is essential to ensure valid and interpretable results. Here is a comprehensive guide to experimental design considerations:

1. Protein Production and Handling:

  • Expression System Consistency:

    • Use identical expression systems for both wild-type and mutant proteins

    • Wheat germ cell-free systems have been successfully used for GJB4

    • Document any differences in expression efficiency between variants

  • Purification Strategy:

    • Apply identical purification protocols

    • Verify comparable purity by SDS-PAGE and other methods

    • Ensure tag position (e.g., N-terminal GST) is consistent across variants

  • Quantification Accuracy:

    • Use multiple methods for protein quantification (Bradford, BCA, A280)

    • Verify concentration before each experiment

    • Account for potential differences in solubility

2. Mutation Selection and Characterization:

  • Disease-Relevant Mutations:

    • Select mutations based on known clinical significance

    • The E204A mutation in the 4th transmembrane domain has been linked to HCM

    • p.Asn119Thr variant has been associated with hearing impairment

  • Structure-Function Considerations:

    • Map mutations to functional domains

    • Consider creating a panel of mutations affecting different domains

    • Include both conservative and non-conservative substitutions

  • Computational Analysis:

    • Perform in silico prediction of mutation effects

    • Molecular modeling to predict structural changes

    • Molecular dynamics simulations to assess dynamic effects

3. Functional Comparison Methodologies:

  • Protein-Protein Interactions:

    • Quantitative binding assays with known partners (e.g., GJA1)

    • Surface Plasmon Resonance (SPR) for kinetic parameters

    • Co-immunoprecipitation with controlled conditions

    • Pull-down assays with consistent protein ratios

  • Structural Assessment:

    • Circular dichroism to detect secondary structure changes

    • Thermal stability measurements (DSF, DSC)

    • Limited proteolysis to identify conformational differences

    • If possible, high-resolution structural studies (X-ray, cryo-EM)

  • Cellular Studies:

    • Transfection efficiency normalization

    • Localization studies with consistent imaging parameters

    • Dye transfer assays with quantitative analysis

    • Electrophysiological studies for functional assessment

4. Controls and Validation:

Control TypePurposeImplementation
Positive controlsConfirm assay functionalityKnown interacting proteins
Negative controlsEstablish backgroundNon-specific proteins, buffer-only
Technical replicatesAssess method variabilityMinimum triplicate measurements
Biological replicatesAccount for biological variationIndependent protein preparations
Reference mutationsBenchmark effectsPreviously characterized mutations

5. Data Analysis and Interpretation:

  • Statistical Approaches:

    • Determine appropriate statistical tests before experiments

    • Power analysis to determine sample size

    • Consider non-parametric tests if normality cannot be assumed

    • Multiple comparison corrections for testing several mutations

  • Quantitative Analysis:

    • Establish clear metrics for comparing variants

    • Use relative measurements (% of wild-type) for better comparison

    • Report effect sizes and confidence intervals

    • Avoid dichotomous "significant/non-significant" interpretations

6. Integrated Analysis:

  • Correlate biochemical findings with cellular phenotypes

  • Connect to animal model observations when available

  • Relate to clinical manifestations in patients with corresponding mutations

By carefully considering these experimental design factors, researchers can generate robust and reproducible comparisons between wild-type and mutant Gjb4 proteins, leading to meaningful insights into connexin biology and disease mechanisms.

How should researchers design experiments to investigate Gjb4 expression patterns across different tissues and disease states?

Designing experiments to investigate Gjb4 expression patterns across different tissues and disease states requires a systematic approach combining multiple methods to ensure comprehensive and accurate results. Here is a detailed methodological framework:

1. Sample Collection and Preparation:

  • Tissue Selection:

    • Include both tissues with known Gjb4 expression and those without

    • For cardiac studies: normal heart tissue, hypertrophic cardiomyopathy, myocardial infarction, pressure overload models

    • For comparison: skin (associated with erythrokeratodermia), cochlear tissues (hearing impairment)

  • Sampling Considerations:

    • Standardize tissue harvesting protocols

    • Consider regional differences within organs (e.g., atria vs. ventricles)

    • Establish strict criteria for disease classification

    • Include appropriate age and sex matching

  • Sample Preservation:

    • Flash freezing for RNA/protein extraction

    • Formalin fixation for histological studies

    • OCT embedding for cryosectioning

    • RNAlater for RNA preservation

2. Transcriptional Analysis:

3. Protein Detection Methods:

  • Western Blotting:

    • Use validated antibodies with appropriate controls

    • Include recombinant Gjb4 as positive control

    • Normalize to housekeeping proteins

    • Consider native PAGE for connexin oligomers

  • Immunohistochemistry/Immunofluorescence:

    • Optimize antigen retrieval for connexin detection

    • Use multiple antibodies targeting different epitopes

    • Include co-staining for cell type markers

    • Perform co-localization studies with other connexins (e.g., GJA1)

4. Experimental Design Matrix:

Disease StateTissue TypesMethodsKey Measurements
NormalHeart, skin, cochleaIHC, WB, qPCRBaseline expression
Hypertrophic cardiomyopathyHeart sections, explantsIHC, IF, WB, RNA-seqExpression level, localization
Myocardial infarctionInfarct, border, remote zonesIHC, IF, scRNA-seqCell-specific expression
Pressure overloadLV, RV, septumqPCR, WB, proteomicsTemporal expression changes
ErythrokeratodermiaSkin biopsiesIHC, RNA-seqExpression in affected vs. unaffected skin
Hearing impairmentCochlear tissuesIHC, IF, in situ hybridizationSpatial expression patterns

5. Advanced Methods for Specific Questions:

  • Temporal Expression Dynamics:

    • Time-course experiments in disease models

    • Inducible disease models with defined onset

    • Single-molecule FISH for transcript visualization

  • Cell-Type Specificity:

    • Flow cytometry/FACS of dissociated tissues

    • Laser capture microdissection

    • Single-cell Western blotting

    • Cell sorting followed by qPCR or RNA-seq

  • Regulatory Mechanisms:

    • Chromatin immunoprecipitation (ChIP) for transcription factor binding

    • ATAC-seq for chromatin accessibility

    • Promoter-reporter assays to study regulation

    • DNA methylation analysis

6. Validation and Integration:

  • Cross-Method Validation:

    • Confirm key findings using orthogonal methods

    • Address discrepancies between RNA and protein levels

    • Validate in multiple independent samples

  • Quantitative Analysis:

    • Use digital image analysis for IHC/IF quantification

    • Develop scoring systems for pattern recognition

    • Apply machine learning for pattern classification

    • Integrated multi-omics analysis

7. Key Considerations Based on Previous Findings:

  • GJB4 is typically not expressed in normal hearts but is induced in diseased cardiac tissue

  • GJB4 co-localizes with GJA1 at intercalated discs in diseased hearts

  • Lateralization observed for GJA1 but not for GJB4 in some disease states

  • GJB4 expression is induced in various cardiac disease models

By implementing this comprehensive methodological framework, researchers can systematically investigate Gjb4 expression patterns across different tissues and disease states, generating robust and reproducible results that advance our understanding of connexin biology in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.