Recombinant Mouse Gap junction beta-6 protein (Gjb6)

Shipped with Ice Packs
In Stock

Description

Hearing Loss Mechanisms

Recombinant Gjb6 is pivotal in studying cochlear gap junction networks. In the inner ear, Cx30 collaborates with Cx26 (Gjb2) to maintain potassium ion recycling, essential for auditory function . Studies using C57BL/6J mice (a model for age-related hearing loss) show that disrupted Gjb6 expression correlates with progressive hearing loss, particularly in high-frequency ranges .

Skin and Nail Disorders

Mutations in Gjb6 cause Clouston syndrome, characterized by nail dystrophy and palmoplantar hyperkeratosis. Recombinant proteins enable functional studies of pathogenic variants (e.g., p.Gly11Val) that impair keratinocyte differentiation .

Biochemical Interactions

  • Co-expression with Cx26: Gjb6 and Cx26 form heteromeric gap junctions in cochlear fibrocytes, with transcript ratios varying by cell type .

  • Oxidative Stress Response: Aging-related hydrophobic shifts in Cx30 structure may contribute to gap junction degradation, exacerbating hearing loss .

Technical Notes for Experimental Use

  • Stability: Avoid repeated freeze-thaw cycles; reconstitute in PBS for short-term use .

  • Activity Assays: Functional validation often involves dye transfer assays to confirm channel permeability .

  • Antibody Validation: Commercial antibodies target epitopes in cytoplasmic loops (e.g., amino acids 100–150) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them during the order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Gjb6; Cxn-30; Gap junction beta-6 protein; Connexin-30; Cx30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Gjb6
Target Protein Sequence
MDWGTLHTVIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGC KNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETARKFIRGEKRNEFKDLED IKRQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDC FISRPTEKTVFTVFMISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESK QNEMNELISDSGQNAITSFPS
Uniprot No.

Target Background

Function
Gap junctions consist of a cluster of closely packed pairs of transmembrane channels, known as connexons. These channels facilitate the diffusion of low-molecular-weight materials from one cell to a neighboring cell.
Gene References Into Functions
  1. Studies have shown that the passive compliance of the cochlear partition and active frequency tuning of the basilar membrane are enhanced in the cochleae of CD-1 onnexin-30 (Cx30)(A88V/A88V) compared to CBA/J mice with sensitive high-frequency hearing. PMID: 28220769
  2. Research findings demonstrate that Cx43, but not Cx30, is crucial for adult neurogenesis in the hippocampus. PMID: 28689039
  3. Connexin 30 regulates astroglial polarity during development. PMID: 29475972
  4. In Cx30 and Cx26 knockout animals, inner hair cells remain in a prehearing developmental stage. PMID: 28077706
  5. Connexin 30, but not connexin 43, hemichannels close upon protein kinase C activation, indicating that connexin hemichannels exhibit not only isoform-specific permeability profiles but also isoform-specific regulation by protein kinase C. PMID: 26400258
  6. Four unique Cx30 mutants might cause disease through different mechanisms, which may also include their selective trans-dominant effects on coexpressed connexins. PMID: 24522190
  7. Cortex modafinil injection increases the expression of mRNA and protein of connexin 30. PMID: 23665355
  8. The Cx30A88V mutation triggers hyperproliferation in the skin and alters cochlear homeostasis in mice. PMID: 24685692
  9. Connexin30 is expressed at significantly higher levels in the buccal mucosa than the epidermis. Unlike in skin, it is rapidly down-regulated at the wound edge within 6 hours of wounding, which may underlie the rapid healing of the buccal mucosa. PMID: 23627777
  10. These observations highlight the role of Cx30 and intercellular communication in regulating repair responses in epithelial tissue. PMID: 23424196
  11. Co-expression of Cx30 and p63 has been observed in developing mouse hair follicles and nail units. PMID: 23219093
  12. In the Cx30 knockout mouse model, defective Cx26 expression is the likely cause of deafness, and contrary to prevailing opinion, Cx30 appears dispensable for cochlear functions. PMID: 23303923
  13. This study demonstrated that Cx30/Cx47 double-deficient mice exhibit a functional role for both connexins in interastrocytic, interoligodendrocytic, and panglial coupling, suggesting that both connexins are necessary for myelin maintenance. PMID: 22649229
  14. Loss of Cx30 and the observed white matter pathology do not affect the expression of experimental autoimmune encephalitis; astrocyte gap junctions do not regulate autoimmune inflammation. PMID: 22342190
  15. This study suggests that Cx30 deficiency impacts the expression levels of glial glutamate transporters within the cerebrum. PMID: 22037505
  16. Tracer coupling analyses in acute slices of Cx30 deficient mice reveal that Cx30 contributes significantly to interastrocytic gap junctional communication in the mouse hippocampus. PMID: 21264956
  17. The results of this study suggest that alterations in astrocyte connexins might be involved in the suicide process, providing further evidence implicating astrocytes in psychopathology. PMID: 21571253
  18. Loss of the ability of ENaC to respond to changes in sodium levels contributes to salt-sensitive hypertension in Cx30(-/-) mice. PMID: 21075848
  19. Cx30 is functionally expressed, albeit at low abundance, in the SA node of the adult mouse heart where it participates in heart rate regulation. PMID: 19679680
  20. Cx30 (Gjb6) deficient mice exhibit a severe constitutive hearing impairment. The Cx30 deficient mice may serve as a valuable model for studying the mechanism of hearing loss in human patients carrying a homozygous deletion of the CX30 gene. PMID: 12490528
  21. Elimination of connexin30 can alter reactivity to novel environments, highlighting the importance of gap-junctional signaling in behavioral processes. PMID: 12911759
  22. Cx30 is abundant in late-pregnant and early lactating gland epithelium. PMID: 17120054
  23. In the absence of the Cx30 gene, Cx26 expressed from extra alleles completely restored hearing sensitivity and prevented hair cell death in deaf Cx30-/- mice. PMID: 17227867
  24. Connexin30 deficiency causes disruption of the intrastrial fluid-blood barrier within the cochlear stria vascularis. PMID: 17400755
  25. Cx30 immunoreactivity has been found extensively in vestibular supporting cells and connective tissue cells. PMID: 17702002
  26. Expression of Cx30 and Cx43 is upregulated in cortical astrocytes cocultured with neurons. PMID: 18512249
  27. Effects of Cx30 null mutation on GJ-mediated ionic and metabolic coupling in the cochlea of mice. PMID: 19116647
  28. Mechanosensitive Cx30 hemichannels play a crucial role in pressure natriuresis by releasing ATP into the tubular fluid, which inhibits salt and water reabsorption. PMID: 19478095

Show More

Hide All

Database Links
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Highly expressed in adult brain and skin. Less in uterus, lung and eye. Very low in testis and sciatic nerve. No expression before birth.

Q&A

What tissues express Gjb6, and what is its physiological significance?

Gjb6 expression has been documented in multiple tissues, with significant presence in:

TissueExpression LevelPhysiological Role
Inner earHighMaintenance of K+ homeostasis for hearing function
BrainModerate to highGlial cell communication and homeostasis
SkinHigh (palms, soles)Epidermal barrier function and differentiation
Hair folliclesModerateHair development and cycling
Nail bedsModerateNail formation and growth

The physiological significance of Gjb6 is most evident in hearing processes, where it forms gap junctions that are essential for maintaining proper potassium ion concentrations in the inner ear. This is critical for the conversion of sound waves to electrical nerve impulses. In the brain, Gjb6 facilitates glial cell communication. In the skin, particularly in palmar and plantar regions, Gjb6 contributes to epidermal barrier function and keratinocyte differentiation .

What are the optimal storage and handling conditions for recombinant mouse Gjb6 protein?

Recombinant mouse Gjb6 protein requires specific storage and handling conditions to maintain its structural integrity and functional activity:

Storage Recommendations:

  • Store lyophilized protein at -20°C for routine use

  • For extended storage, maintain at -80°C

  • After reconstitution, store working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening

  • Reconstitute to a concentration of 50 μg/mL using an appropriate buffer (typically Tris-based buffer with 50% glycerol)

  • Gently mix to ensure complete solubilization

  • Prepare small working aliquots to minimize freeze-thaw cycles

  • For experimental use, dilute to working concentrations in appropriate assay buffers

When handling the protein, maintain sterile conditions and use low-protein binding tubes to prevent loss through surface adsorption. Temperature fluctuations should be minimized during all handling procedures.

How can I validate the activity of recombinant mouse Gjb6 protein in experimental systems?

Validating recombinant mouse Gjb6 protein activity requires multiple complementary approaches:

Functional Validation Approaches:

  • Gap Junction Communication Assays:

    • Dye transfer assays using Lucifer Yellow or calcein to measure intercellular communication

    • Measure electrical coupling between cells using dual patch-clamp techniques

    • Assess recovery after photobleaching (FRAP) to measure gap junction-mediated molecular exchange

  • Structural Validation:

    • Western blot analysis using anti-Gjb6 antibodies

    • Immunofluorescence to verify membrane localization and typical punctate pattern

    • Size exclusion chromatography to confirm hexameric assembly

  • Hemichannel Activity:

    • ATP release assays in low calcium conditions

    • Dye uptake assays using propidium iodide or ethidium bromide

A comprehensive validation should include both functional and structural analyses to confirm that the recombinant protein forms functional channels with properties similar to native Gjb6.

How does recombinant mouse Gjb6 protein interact with other connexin family members?

Recombinant mouse Gjb6 protein demonstrates specific interaction patterns with other connexin family members, which influences gap junction composition and function:

Homotypic and Heterotypic Interactions:

Interaction TypeCompatible PartnersFunctional Consequences
HomotypicGjb6-Gjb6Forms fully functional channels with high conductance
HeterotypicGjb6-Gjb2 (Cx26)Forms functional channels; important in the inner ear
HeterotypicGjb6-Gjb1 (Cx32)Limited compatibility; restricted channel function
HeterotypicGjb6-Gja1 (Cx43)Minimal compatibility; rarely forms functional channels

These interaction patterns are critical when studying Gjb6 in complex tissue environments. In the inner ear, Gjb6 predominantly forms heteromeric channels with Gjb2 (Connexin-26), which are essential for proper hearing function. When conducting in vitro studies with recombinant Gjb6, researchers should consider the endogenous connexin expression profile of their cellular model to account for potential heteromeric channel formation .

The interaction between Gjb6 and other connexins can be experimentally assessed through co-immunoprecipitation, proximity ligation assays, or fluorescence resonance energy transfer (FRET) using tagged connexin variants.

What are the differences between human GJB6 and mouse Gjb6 proteins that researchers should consider?

Understanding the differences between human GJB6 and mouse Gjb6 proteins is crucial for translational research and interpretation of experimental results:

Key Differences Between Human GJB6 and Mouse Gjb6:

FeatureHuman GJB6Mouse Gjb6Research Implications
Amino acid homology100% (reference)~87% identityMay affect antibody cross-reactivity
Channel conductance160-200 pS140-180 pSSubtle functional differences in electrophysiology
RegulationMore sensitive to pH changesLess sensitive to pHDifferent responses to physiological stressors
Disease mutationsMultiple identified in Clouston syndromeFewer characterized mutationsModel selection for disease studies

These differences become particularly important when:

  • Using mouse models to study human GJB6-related diseases

  • Developing therapeutic approaches targeting GJB6

  • Interpreting electrophysiological data across species

  • Selecting antibodies for detection of either human or mouse protein

Researchers should validate their experimental approaches when transitioning between human and mouse systems, especially for functional studies where subtle differences in channel properties might significantly impact results.

How can recombinant mouse Gjb6 protein be used to study connexin-related hearing disorders?

Recombinant mouse Gjb6 protein serves as a valuable tool for investigating connexin-related hearing disorders, particularly nonsyndromic hearing loss associated with GJB6 mutations:

Research Applications for Hearing Disorder Studies:

  • Functional Characterization of Mutations:

    • Compare wild-type recombinant Gjb6 with mutant variants to assess channel function

    • Measure alterations in potassium permeability associated with specific mutations

    • Evaluate protein trafficking and membrane insertion defects of mutant proteins

  • Cochlear Explant Culture Supplementation:

    • Apply recombinant Gjb6 to cochlear explants from Gjb6-null mice to assess rescue effects

    • Monitor potassium homeostasis restoration using fluorescent indicators

    • Evaluate hair cell preservation in supplemented vs. non-supplemented cultures

  • Interaction Studies with Hearing-Related Proteins:

    • Investigate binding partners specific to inner ear tissues

    • Assess competitive binding between wild-type and mutant Gjb6 variants

    • Characterize protein complexes in potassium recycling pathways

What role does Gjb6 play in Clouston syndrome, and how can recombinant protein studies advance our understanding?

Clouston syndrome (hidrotic ectodermal dysplasia 2) is directly linked to mutations in the GJB6 gene, and recombinant protein studies offer critical insights into disease mechanisms:

Gjb6 Mutations in Clouston Syndrome:

MutationProtein ChangeFunctional ImpactClinical Manifestation
G11RGlycine to Arginine at position 11Impaired channel assemblySevere nail dystrophy, palmoplantar keratoderma
A88VAlanine to Valine at position 88Altered channel permeabilityHair loss, thickened skin on palms/soles
V37EValine to Glutamic acid at position 37Trafficking defectsNail abnormalities, hypotrichosis
D50NAspartic acid to Asparagine at position 50Dominant negative effectModerate to severe ectodermal features

Research Applications Using Recombinant Protein:

  • Structural Studies:

    • Compare protein folding between wild-type and mutant Gjb6 using circular dichroism

    • Assess oligomerization patterns using size exclusion chromatography

    • Investigate protein stability differences through thermal shift assays

  • Cellular Models:

    • Introduce recombinant mutant proteins into keratinocyte cultures to observe dominant-negative effects

    • Evaluate effects on cell proliferation, differentiation, and apoptosis in skin models

    • Measure intercellular calcium wave propagation to assess gap junction functionality

  • Therapeutic Development:

    • Screen compounds that may stabilize mutant protein folding

    • Test peptide mimetics that could restore channel function

    • Evaluate gene therapy approaches using functional recombinant protein as benchmark

These studies with recombinant Gjb6 protein help elucidate how specific mutations lead to the characteristic skin, hair, and nail abnormalities observed in Clouston syndrome patients .

What are the critical factors to consider when designing experiments to study Gjb6 post-translational modifications?

Post-translational modifications (PTMs) of Gjb6 significantly influence its trafficking, channel properties, and protein-protein interactions. Consider these critical factors when designing experiments:

Key Experimental Considerations:

  • Sample Preparation:

    • Use phosphatase inhibitors to preserve phosphorylation status

    • Include deubiquitinase inhibitors when studying ubiquitination

    • Maintain reducing conditions to preserve native disulfide bonds

    • Avoid harsh detergents that may disrupt protein modifications

  • Detection Methods:

    • Mass spectrometry: Use both bottom-up and top-down approaches for comprehensive PTM mapping

    • Phospho-specific antibodies: Validate antibody specificity using dephosphorylated controls

    • Site-directed mutagenesis: Create modification-resistant variants (e.g., S→A for phosphorylation sites)

  • Physiological Context:

    • Consider tissue-specific modification patterns (inner ear vs. skin)

    • Account for changes in PTM status during cell cycle progression

    • Evaluate modification changes in response to cellular stressors

Common PTMs in Gjb6 and Their Functional Impacts:

ModificationSitesFunctional ImpactDetection Method
PhosphorylationSer, Thr residues in C-terminal tailChannel gating, protein half-lifePhospho-specific antibodies, MS/MS
UbiquitinationLys residues in cytoplasmic domainsProtein degradation, internalizationUbiquitin pulldown, MS analysis
SUMOylationConsensus motifs in N-terminal domainTrafficking, protein-protein interactionsSUMO-IP, SUMO-site mutants
S-NitrosylationCys residues in transmembrane domainsChannel permeability, response to oxidative stressBiotin switch technique, MS analysis

When publishing results, include detailed methodological descriptions of how PTMs were preserved during sample processing to ensure reproducibility.

How can advanced imaging techniques be optimized for studying Gjb6 dynamics in living systems?

Advanced imaging techniques provide powerful insights into Gjb6 dynamics, but require careful optimization:

Recommended Imaging Approaches:

  • Super-Resolution Microscopy:

    • STORM/PALM: Achieve 20-30 nm resolution of Gjb6 gap junction plaques

    • Optimization parameters: Use photoconvertible fluorophores with low blinking rates

    • Critical consideration: Balance between photostability and localization precision

  • Live-Cell FRET Imaging:

    • Application: Monitor Gjb6 protein-protein interactions in real-time

    • Optimal fluorophore pairs: mTurquoise2-SYFP2 or GFP-mCherry for Gjb6 tagging

    • Key protocol modification: Insert fluorophores at C-terminus to minimize functional disruption

    • Validation required: Confirm channel functionality with dye transfer assays after tagging

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Purpose: Measure lateral mobility and exchange rates of Gjb6 in gap junction plaques

    • Optimization parameters:

      • Bleach spot size: 1-2 μm diameter (smaller than typical Gjb6 plaques)

      • Laser power: 80-90% for complete bleaching without photodamage

      • Acquisition frequency: 1 frame/5 seconds to capture recovery kinetics

    • Analysis approach: Fit recovery curves with double exponential models to distinguish between free and plaque-incorporated Gjb6

Protocol Optimization Table for Live Imaging of Gjb6:

ParameterRecommended SettingRationaleCommon Pitfall
Expression levelLow to moderateHigh overexpression causes artificial aggregationMisinterpreting aggregates as functional plaques
Imaging bufferHBSS with 1.8 mM Ca²⁺Maintains gap junction stabilityLow calcium leads to hemichannel opening
Temperature35-37°CPhysiological trafficking dynamicsRoom temperature slows turnover rates
Time resolution10-15 min intervalsCaptures plaque formation/internalizationToo frequent imaging causes phototoxicity
Z-stack spacing0.3-0.5 μmCaptures complete 3D structure of plaquesInsufficient z-resolution misses vertical dynamics

For optimal results, conduct parallel electrophysiological measurements to correlate observed structural dynamics with functional changes in gap junction communication.

What are common challenges in producing functional recombinant mouse Gjb6 protein, and how can they be addressed?

Producing functional recombinant mouse Gjb6 protein presents several challenges due to its multiple transmembrane domains and complex oligomerization requirements:

Common Production Challenges and Solutions:

  • Low Expression Yields:

    • Challenge: Hydrophobic transmembrane domains often lead to protein aggregation

    • Solution: Use specialized expression systems such as Pichia pastoris or insect cell systems

    • Optimization approach: Test multiple fusion tags (MBP, SUMO) to enhance solubility

    • Validation metric: Achieve minimum yield of 1-2 mg/L culture with >80% purity

  • Improper Folding:

    • Challenge: Misfolded Gjb6 forms non-functional aggregates

    • Solution: Include mild detergents during purification (0.1% DDM or 0.5% CHAPS)

    • Advanced approach: Incorporate membrane scaffold proteins for nanodisc formation

    • Quality control: Circular dichroism to confirm alpha-helical content of transmembrane domains

  • Oligomerization Issues:

    • Challenge: Failure to form proper hexameric connexons

    • Solution: Optimize detergent:protein ratio during purification

    • Analytical method: Blue native PAGE to confirm hexamer formation

    • Alternative approach: Co-expression with compatible connexins to promote oligomerization

Optimization Protocol for Functional Gjb6 Production:

StepCritical ParametersTroubleshooting Strategy
Expression vectorCMV promoter for mammalian cells; pPICZ for yeastAdd kozak sequence to enhance translation initiation
Cell line selectionHEK293 (mammalian) or SF9 (insect) cellsTest multiple cell lines for highest functional expression
Induction conditions0.5-1 mM IPTG at 18°C for 16-20 hoursLower temperature reduces inclusion body formation
Lysis buffer50 mM Tris pH 7.5, 150 mM NaCl, 1% DDMInclude protease inhibitors and 10% glycerol for stability
PurificationTwo-step: affinity chromatography + gel filtrationAnalyze fractions by Western blot for Gjb6 oligomers

After purification, validate functionality through reconstitution into liposomes and measuring channel conductance using planar lipid bilayer electrophysiology.

How can researchers troubleshoot inconsistent results when studying Gjb6 interactions with other proteins?

Inconsistent results in Gjb6 interaction studies often stem from technical variations and biological complexity:

Common Sources of Variability and Solutions:

  • Protein Conformation Issues:

    • Problem: Native conformation loss during purification affects interaction profiles

    • Solution: Use mild detergents and avoid harsh elution conditions

    • Validation approach: Compare recombinant protein circular dichroism spectra with native protein

    • Implementation strategy: Include positive control interactions in each experiment

  • Cell Type-Specific Interactions:

    • Problem: Supporting proteins required for interactions vary between cell types

    • Solution: Use cell types that endogenously express Gjb6 and interaction partners

    • Advanced approach: Supplement in vitro systems with tissue-specific lysates

    • Documentation requirement: Clearly report cell type and passage number in methods

  • Post-Translational Modification Variations:

    • Problem: Interaction strength depends on PTM status

    • Solution: Characterize PTM profile of your Gjb6 preparation by MS analysis

    • Consistency approach: Use standardized phosphatase inhibitor cocktails

    • Quality control: Include phosphorylation-state dependent controls

Systematic Troubleshooting Workflow:

IssueDiagnostic TestResolution StrategyValidation Method
No interaction detectedPositive control with known interactorModify buffer conditions (salt, pH)Co-IP with native tissue samples
Non-specific bindingSecondary antibody-only controlsIncrease blocking agent concentrationCompetition assays with unlabeled protein
Inconsistent Co-IP resultsCheck Gjb6 extraction efficiencyOptimize detergent type and concentrationQuantitative Western blot of input fractions
Variable FRET signalsTest fluorophore maturationStandardize expression levelsAcceptor photobleaching controls

When publishing interaction studies, include detailed characterization of the recombinant protein preparation used, and explicitly state buffer conditions, as slight variations in pH or ionic strength can significantly affect Gjb6 interactions with partner proteins.

What emerging technologies could advance our understanding of Gjb6 function in complex tissue environments?

Several cutting-edge technologies show promise for elucidating Gjb6 functions in native tissue contexts:

Emerging Technologies and Applications:

  • Cryo-Electron Microscopy:

    • Application: Determine high-resolution structures of Gjb6 gap junctions in different functional states

    • Advantage: Visualize native conformations without crystallization

    • Research potential: Identify structural changes associated with channel gating and permeability regulation

    • Implementation strategy: Compare wild-type and disease-associated mutant structures

  • Optogenetic Control of Gjb6 Channels:

    • Approach: Develop light-sensitive Gjb6 variants through strategic insertion of photosensitive domains

    • Application: Precisely control gap junction communication in specific cell populations

    • Research impact: Dissect the temporal aspects of Gjb6-mediated intercellular communication

    • Validation requirement: Confirm that optical manipulation recapitulates physiological regulation

  • Single-Cell Proteomics:

    • Technology: Mass spectrometry-based analysis of Gjb6 interactome at single-cell resolution

    • Application: Map cell type-specific Gjb6 interaction networks in complex tissues

    • Advantage: Reveals heterogeneity in Gjb6 function across different cell populations

    • Implementation challenge: Requires development of highly sensitive detection methods

These emerging approaches will help resolve current controversies regarding tissue-specific functions of Gjb6 and could lead to more targeted therapeutic approaches for Gjb6-related disorders.

How might gene editing approaches be optimized for studying Gjb6 function in disease models?

Gene editing technologies offer powerful tools for investigating Gjb6 function, but require careful optimization:

CRISPR-Based Approaches for Gjb6 Research:

  • Knock-in Strategies for Endogenous Tagging:

    • Recommended approach: CRISPR HDR to insert fluorescent tags at the C-terminus

    • Optimization parameter: Use short homology arms (500-800 bp) flanking the stop codon

    • Validation method: Confirm normal localization and function of tagged protein

    • Critical consideration: Include flexible linker sequences to minimize functional disruption

  • Generation of Disease-Specific Mutations:

    • Precision requirement: Design guide RNAs with high on-target and low off-target scores (>85/< 5)

    • Verification approach: Deep sequencing to confirm exact mutation without additional alterations

    • Cell type consideration: Edit in relevant cell types (cochlear cells for hearing loss, keratinocytes for skin disorders)

    • Control strategy: Generate parallel isogenic wild-type lines through the same process

  • Conditional Knockout Models:

    • Design strategy: Flank exons 1-2 with loxP sites to ensure complete functional disruption

    • Tissue specificity: Use appropriate tissue-specific Cre drivers (Krt14-Cre for skin, Foxg1-Cre for inner ear)

    • Temporal control: Consider tamoxifen-inducible systems to study Gjb6 in adult tissues

    • Phenotypic analysis: Comprehensive assessment of tissue function before and after deletion

Optimization Parameters for Gjb6 Gene Editing:

ParameterRecommended ApproachVerification MethodCommon Pitfall
Guide RNA designTarget early exons; avoid regions with connexin homologyT7E1 assay for editing efficiencyOff-target effects in other connexin genes
Delivery methodAAV for in vivo; nucleofection for primary cellsGFP reporter to track delivery efficiencyLow editing efficiency in post-mitotic cells
Clone selectionScreen >20 clones for precise editsSanger sequencing of junction regionsMissing large insertions/deletions
Functional validationDye transfer and electrophysiologyCompare to wild-type controlsCompensatory upregulation of other connexins

These gene editing approaches enable unprecedented precision in modeling Gjb6-related diseases and elucidating fundamental aspects of gap junction biology in physiologically relevant contexts.

What are the key considerations for translating mouse Gjb6 research findings to human applications?

Translating mouse Gjb6 research to human applications requires careful consideration of species differences and methodological factors:

  • Species-specific protein characteristics must be accounted for, as human GJB6 and mouse Gjb6 share approximately 87% amino acid identity, with differences potentially affecting channel properties, interaction partners, and regulatory mechanisms.

  • Disease-associated mutations should be validated in both species, as the functional consequences of specific mutations may differ between human and mouse proteins due to differences in cellular environments and compensatory mechanisms.

  • Pharmacological interventions targeting connexin channels require cross-species validation, with careful dose-response studies and specificity testing to ensure similar effects in both mouse models and human systems.

Researchers should employ multiple model systems, including mouse models, human cell lines, and patient-derived samples when possible, to strengthen translational relevance of their findings and improve the predictive value of preclinical studies for human applications.

What quality control standards should be implemented when working with recombinant mouse Gjb6 protein?

Implementing rigorous quality control standards is essential for reliable research with recombinant mouse Gjb6 protein:

  • Purity assessment should include SDS-PAGE (>95% purity), Western blotting with specific antibodies, and mass spectrometry verification of the intact protein mass and sequence coverage.

  • Functional validation must confirm proper folding and assembly through circular dichroism spectroscopy and the ability to form functional channels as measured by appropriate bioassays.

  • Batch-to-batch consistency testing is critical, with standardized functional assays performed on each production lot to ensure comparable activity levels and minimize experimental variability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.