Recombinant Mouse Gap junction delta-4 protein (Gjd4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Gjd4; Gap junction delta-4 protein; Connexin-39; Cx39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Gjd4
Target Protein Sequence
MEKLNLLGFLIITLNCNVTIMGMIWLIVEVLLRMLVVVLAGSPIYEDEQERFICNTLQPG CANVCYDLFSPVSPLRFWLVQSLALLLPSVVFGTYTLHRGAKLAAVGGACRPQVPDLSTA YLVHLLLRMLLEAGLAFLHYFLFGFSVPARVSCSHVPCSGAVDCYVSRPTEKSLLILFFW AVSALSFLLSLADLLWILPRRKTLRTTQWVNGEARPVCEVPAPPPCLLQNPQGYLSQGQV DQEDRQEEQVVPEFPCMWTAGQSDNSNVGQACVSGLLEHSDQDASEATSSAGDRLTVAHT AHELRFHRETSLDLGGKNTQADELSLATQSHLARHSSASKPQAPCRLTTSGSAPHLRTKK SEWV
Uniprot No.

Target Background

Function
Gap junctions are composed of clusters of closely packed connexon pairs, transmembrane channels facilitating the diffusion of low-molecular-weight materials between adjacent cells.
Gene References Into Functions
  1. Studies indicate that myogenesis is accelerated in Cx39 knockout mice due to increased myogenin expression at embryonic days 13.5 and 16.5, and elevated Cx43 in developing skeletal muscle, suggesting Cx43 may compensate for Cx39 loss during myogenesis and regeneration. PMID: 21272575
  2. Connexin39 gene expression is observed in developing striated muscle fibers. PMID: 15466892
  3. Cx39 expression increases during myotube differentiation in mouse embryos. PMID: 16613780
  4. Immunofluorescence staining reveals abundant Cx37 and Cx43 puncta within the zona pellucida of preantral and antral follicles. PMID: 16613781
Database Links
Protein Families
Connexin family, Delta-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is the basic structure and function of mouse Gjd4?

Gjd4 belongs to the connexin family of gap junction proteins that create direct intercellular communication channels. These channels facilitate the movement of ions and small molecules between adjacent cells. The mouse Gjd4 protein (also referred to as Connexin 40.1 in some literature) contains four transmembrane domains, two extracellular loops, one intracellular loop, and cytoplasmic N- and C-terminal regions . The C-terminal tail shows significant amino acid variance among homologues, while the N-terminus, transmembrane domains, and extracellular domains are more highly conserved .

Gap junction channels formed by Gjd4 are essential for bioelectric coordination between cells, providing a fast, direct pathway for cellular communication that is critical in various developmental and physiological processes .

How does mouse Gjd4 differ from its human ortholog?

The human ortholog of mouse Gjd4 is GJD4 (Gap Junction Protein Delta 4), also known as CX40.1. Evolutionary analysis suggests that CX40.1 has developed different expression patterns and presumably different functions compared to its mouse ortholog . The human GJD4 protein consists of 370 amino acids with a molecular weight of approximately 41 kDa . While sharing structural similarities as connexin family members, the specific differences in expression patterns and functional roles highlight the importance of species-specific research when studying gap junction proteins.

What is the typical expression pattern of Gjd4 in mouse tissues?

While comprehensive expression data for mouse Gjd4 is limited in the provided search results, we can infer from comparative studies with other species that Gjd4 likely shows tissue-specific expression. For instance, in zebrafish, gjd4 is expressed exclusively within developing slow muscle cells as early as 18 hours post-fertilization (hpf), with expression levels peaking at 24 hpf . The expression is detected in both MP (muscle pioneer) and SSF (superficial slow fiber) slow muscle cell subtypes .

How are recombinant mouse Gjd4 proteins typically produced?

Recombinant mouse Gjd4 proteins are typically produced using bacterial expression systems such as E. coli. Though the search results don't provide specific protocols for Gjd4, similar gap junction proteins are often expressed as full-length proteins covering the entire amino acid sequence (e.g., Met1 to the C-terminus). Following expression, these proteins undergo purification processes to ensure high purity for experimental applications . For optimal results, researchers should verify protein activity through functional assays appropriate for gap junction proteins.

What techniques are most effective for studying Gjd4 localization in cells and tissues?

Based on successful approaches with similar proteins, several techniques have proven effective for studying Gjd4 localization:

  • Fluorescent protein tagging: Creating fusion proteins with small epitope tags such as V5 has been successful for visualizing connexin proteins. For instance, researchers have used CRISPR to introduce a V5 epitope tag into the C-terminal tail of the gjd4 locus in zebrafish, creating a precisely edited transgenic line that allows visualization of protein expression and localization .

  • Immunofluorescence: Using antibodies against Gjd4 or epitope tags for confocal microscopy. This technique revealed that Cx46.8-V5 (zebrafish Gjd4) expression is punctate and localizes at sites of intercellular contact, with pronounced localization at the myotendinous junctions between somites .

  • Fluorescent RNA in situ hybridization: This method can detect gjd4 transcript localization and has been effectively used to show exclusive expression within developing slow muscle cells in zebrafish .

How can I optimize experimental protocols to study gap junction-mediated intercellular communication involving Gjd4?

To study gap junction-mediated communication involving Gjd4:

  • Dye transfer assays: Use gap junction-permeable dyes like Lucifer Yellow or Neurobiotin to assess functional coupling between cells expressing Gjd4.

  • Electrophysiological measurements: Dual whole-cell patch-clamp recordings can provide direct measurements of electrical coupling between cells expressing Gjd4.

  • Calcium imaging: Using calcium indicators like GCaMP3 can help visualize and quantify intercellular calcium wave propagation through Gjd4 gap junctions. This approach has been successfully used in transgenic zebrafish lines (e.g., Tg(smyhc1:GCaMP3)) to investigate gap junction function in muscle cells .

  • CRISPR-edited animal models: Creating precisely tagged versions of Gjd4 (like the Pt(gjd4/Cx46.8-V5) line in zebrafish) allows visualization of protein expression patterns while maintaining native regulation .

How do mutations in Gjd4 affect gap junction function and related cellular processes?

The functional impact of Gjd4 mutations likely varies depending on the affected protein domain:

  • Mutations in transmembrane domains: May disrupt channel formation or permeability, potentially altering the movement of ions and small molecules between cells.

  • Mutations in extracellular loops: Could affect connexon docking and gap junction formation between adjacent cells.

  • C-terminal mutations: Might impact protein-protein interactions and channel regulation, as the C-terminal tail shows significant variability among connexin homologues and often contains regulatory sites .

Experimental approaches to study these effects include site-directed mutagenesis, expression of mutant proteins in cell culture, and creation of knock-in animal models with specific mutations.

What is the current understanding of Gjd4's role in bioelectric signaling during development?

Gap junction channels mediated by proteins like Gjd4 play crucial roles in bioelectric signaling during development. In zebrafish, gjd4 has been specifically implicated in bioelectric coordination required for slow muscle development .

The protein shows a specific expression pattern, with Cx46.8-V5 (zebrafish Gjd4) being expressed in both MP and SSF slow muscle cell subtypes as early as 18 hpf, with protein present until 48 hpf . Within these cells, the protein localizes at sites of intercellular contact, with pronounced localization at the myotendinous junctions between somites, and more dispersed localization along the dorsal and ventral surfaces of muscle cells .

This specific localization pattern suggests Gjd4 plays important roles in coordinating cellular activity during muscle development, potentially through the propagation of electrical or chemical signals between developing muscle cells.

What are the best methods for detecting and quantifying Gjd4 expression in different tissues?

Several complementary approaches can be used to detect and quantify Gjd4 expression:

  • RNA-level detection:

    • RT-qPCR for quantitative measurement of gjd4 transcript levels

    • RNA in situ hybridization for spatial localization of transcripts, which has successfully detected gjd4 expression in developing slow muscle cells

    • Single-cell RNA sequencing (scRNA-seq) to identify cell types expressing gjd4

  • Protein-level detection:

    • Western blotting using specific antibodies against Gjd4 or epitope tags

    • Immunohistochemistry and immunofluorescence for visualizing protein localization

    • Flow cytometry for quantifying protein expression in cell populations

  • Functional assessment:

    • Gap junction-permeable dye transfer assays

    • Electrophysiological measurements of intercellular coupling

How can I establish a reliable cell culture model for studying Gjd4 function?

To establish a reliable cell culture model for studying Gjd4 function:

  • Cell line selection: Choose cell lines with minimal endogenous connexin expression to avoid interference, or use connexin-deficient cell lines.

  • Expression system options:

    • Transient transfection with Gjd4 expression vectors

    • Stable cell lines with inducible Gjd4 expression

    • CRISPR/Cas9-mediated tagging of endogenous Gjd4

  • Verification of expression and function:

    • Confirm protein expression by Western blotting and immunofluorescence

    • Verify subcellular localization patterns, looking for punctate expression at cell-cell contacts similar to what has been observed in vivo

    • Assess gap junction function using dye transfer or electrophysiological methods

  • Experimental controls:

    • Include connexin-deficient controls

    • Use gap junction blockers (e.g., carbenoxolone) to confirm gap junction-specific effects

    • Compare with cells expressing other connexin family members

What are the critical considerations when designing CRISPR/Cas9 experiments to study Gjd4?

When designing CRISPR/Cas9 experiments to study Gjd4, consider the following:

  • Target site selection:

    • For knock-out studies, target early exons or critical functional domains

    • For tagging, target the C-terminal region, which shows greater amino acid variance among connexin homologues and has been successfully tagged in similar proteins

    • Avoid regions with high sequence similarity to other connexins to prevent off-target effects

  • Tag design for visualization studies:

    • Small epitope tags (e.g., V5, FLAG, HA) are preferable for connexins to minimize functional disruption

    • Consider inserting tags in the C-terminal tail of Gjd4, as successfully done with the zebrafish ortholog

    • Ensure the tag doesn't disrupt critical protein-protein interactions or trafficking signals

  • Verification strategies:

    • Confirm genomic editing by sequencing

    • Verify protein expression and localization

    • Assess gap junction functionality using functional assays

    • Compare phenotypes with traditional knockout or knockdown approaches

  • Controls and rescue experiments:

    • Include appropriate controls for CRISPR experiments

    • Design rescue experiments with wild-type Gjd4 to confirm specificity of observed phenotypes

How conserved is Gjd4 across species, and what can this tell us about its function?

Gap junction proteins show varying degrees of conservation across species, with functional domains typically more conserved than regulatory regions. For Gjd4 and its orthologs:

  • Structural conservation: The N terminus, four transmembrane domains, two extracellular domains, and intracellular loop show higher conservation across species, reflecting their critical roles in gap junction structure and function .

  • Divergence in C-terminal regions: The intracellular C-terminal tail shows greater amino acid variance among homologues , suggesting species-specific regulatory mechanisms.

  • Functional divergence: Human CX40.1 (GJD4) appears to have evolved different expression patterns and presumably different functions compared to its mouse ortholog , highlighting the importance of species-specific studies.

This pattern of conservation and divergence suggests that the core channel-forming functions are likely conserved, while regulatory aspects and tissue-specific roles may have evolved differently across species.

How does Gjd4 function compare to other connexin family members in research models?

Gap junction proteins form a diverse family with different biophysical properties, expression patterns, and functions:

  • Channel properties: Different connexins form channels with distinct permeability and gating properties. While specific data for Gjd4 is limited in the search results, connexin channels generally vary in their permeability to ions and small molecules up to approximately 1-1.5 kDa.

  • Expression patterns: Unlike some widely expressed connexins, Gjd4 appears to have a more restricted expression pattern, as observed in zebrafish where gjd4 is expressed exclusively in developing slow muscle cells .

  • Subcellular localization: Similar to other connexins, Gjd4 shows punctate localization at cell-cell contacts, with specific enrichment at certain cellular regions (e.g., myotendinous junctions in zebrafish muscle cells) .

  • Developmental roles: Gap junction proteins often have specific developmental functions. In zebrafish, gjd4 is implicated in bioelectric coordination required for slow muscle development , representing a specialized function compared to more broadly expressed connexins.

Is there evidence linking Gjd4 to specific disease models or pathological conditions?

While the search results don't provide direct evidence linking mouse Gjd4 to specific diseases, research on related gap junction proteins suggests potential areas for investigation:

  • Muscle development and myopathies: Given the expression of gjd4 in developing slow muscle cells in zebrafish , Gjd4 might play roles in muscle development or function in mice, potentially relevant to myopathy models.

  • Cancer research: Studies on other gap junction proteins have revealed roles in cancer progression. For example, GJA4 expression has been correlated with colorectal cancer prognosis and tumor microenvironment interactions . This suggests that investigating Gjd4 in cancer models might yield valuable insights.

  • Bioelectric signaling disorders: As gap junction proteins mediate bioelectric coordination between cells , Gjd4 dysfunction might contribute to conditions involving disrupted intercellular communication.

How can recombinant Gjd4 be used in screening for potential therapeutic compounds?

Recombinant Gjd4 proteins can be valuable tools for therapeutic development:

  • In vitro binding assays: Purified recombinant Gjd4 can be used to screen for compounds that specifically bind to this protein, potentially modulating gap junction function.

  • Functional assays in cell culture: Cells expressing recombinant Gjd4 can be used to screen for compounds that affect gap junction communication, using readouts such as dye transfer or electrical coupling.

  • Structure-based drug design: If structural information is available, recombinant Gjd4 could support the development of compounds targeting specific protein domains.

  • Interaction screening: Recombinant Gjd4 could help identify protein-protein interactions that might be therapeutic targets, especially interactions that regulate gap junction assembly or function.

When developing such screening approaches, researchers should include appropriate controls and validation steps to ensure the specificity and relevance of identified compounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.