Recombinant Mouse Gap junction gamma-1 protein (Gjc1)

Shipped with Ice Packs
In Stock

Description

Expression Patterns and Functional Roles

Gjc1 is expressed in diverse tissues, with specialized roles in cardiovascular and lymphatic systems:

Tissue-Specific Expression

Gjc1 is prominently expressed in:

  • Cardiomyocytes: Contributes to electrical coupling and synchronized contraction .

  • Lymphatic endothelial cells (LECs): Critical for lymphatic valve development and maintenance .

  • Vascular smooth muscle: Regulates vasculogenesis and endothelial barrier function .

Tissue/Cell TypeFunction
Lymphatic endotheliumValve leaflet formation; backflow prevention
Cardiac conduction systemAtrioventricular delay regulation
OsteoblastsInteraction with ZO-1 for cell adhesion

In lymphatic networks, Gjc1 deletion leads to shortened valve leaflets and increased backflow, mimicking defects observed with Cx43 loss .

Lymphatic Valve Development

Studies using Lyve1-Cre and Prox1-CreERT2 mouse models revealed:

  • Valve morphogenesis: Gjc1 is required for proper leaflet length and symmetry during embryonic development .

  • Valve maintenance: Postnatal deletion (e.g., via tamoxifen-inducible Cre) causes functional defects in mature valves, indicating ongoing roles in adult LECs .

Cardiovascular Roles

Gjc1 interacts with Cx40 and Cx43 to regulate:

  • Electrical conduction: Modulates action potential propagation in atrial and nodal regions .

  • Vasculogenesis: Supports endothelial cell migration and vascular remodeling .

Mechanistic Insights and Pathway Interactions

Gjc1 participates in:

  • Gap junction assembly: Forms heteromeric channels with Cx40 or Cx43 to regulate ion selectivity .

  • Signaling pathways: Interacts with kinases (e.g., PKC) and transcription factors (e.g., GATA4) .

Disease Associations

While not directly linked to human diseases, Gjc1 orthologs (e.g., human GJC1) are implicated in:

  • Oculodentodigital dysplasia: Mutations in GJA1 (Cx43) highlight the broader role of connexins in development .

  • Lymphedema: GJC2 mutations underscore the importance of connexins in lymphatic function .

Protein Purification

Recombinant Gjc1 is purified via:

  1. Affinity chromatography: Using His-tags or GST fusions .

  2. Gel filtration: To ensure oligomerization state .

Antibody Validation

Anti-Gjc1 antibodies are validated via:

  • Western blot: Bands at ~45 kDa in lysates of transfected cells .

  • Blocking peptides: Confirm specificity by pre-incubation with immunizing peptides .

Future Directions and Emerging Research

  • Therapeutic targeting: Gjc1 may serve as a biomarker for cardiovascular or lymphatic disorders.

  • Structural studies: Cryo-EM of Gjc1-containing channels to elucidate gating mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing it for your order.
Synonyms
Gjc1; Cxn-45; Gja7; Gap junction gamma-1 protein; Connexin-45; Cx45; Gap junction alpha-7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Gjc1
Target Protein Sequence
MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGC ENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMR WKQHRALEETEEDHEEDPMMYPEMELESEKENKEQSQPKPKHDGRRRIREDGLMKIYVLQ LLARTVFEVGFLIGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTG LCLLLNIWEMLHLGFGTIRDSLNSKRRELDDPGAYNYPFTWNTPSAPPGYNIAVKPDQIQ YTELSNAKIAYKQNKANIAQEQQYGSHEEHLPADLETLQREIRMAQERLDLAIQAYHHQN NPHGPREKKAKVGSKSGSNKSSISSKSGDGKTSVWI
Uniprot No.

Target Background

Function
A gap junction comprises a cluster of closely packed pairs of transmembrane channels, known as connexons, that facilitate the diffusion of low molecular weight materials between adjacent cells.
Gene References Into Functions
  1. Punctate labeling of Cx45 was faintly observed in the cerebellar cortex molecular layer of wild-type mice and exhibited increased intensity in mice with Cx36 gene ablation. The majority of Cx36-puncta co-localized with Cx45-puncta, which was associated with the scaffolding protein zonula occludens-1. PMID: 28561933
  2. Connexin45 carboxyl-terminal domain structure and interactions with molecular partners PMID: 24853747
  3. Ablation of Cx45 reduced neuronal loss by approximately 50% under ischemic insult. PMID: 25100592
  4. Using Cx45-eGFP transgenic mice, this study demonstrated that Cx45-eGFP cells are distributed along the rostrocaudal extent of the spinal cord, with expression primarily confined to the grey matter of dorsal laminae I-III PMID: 22638825
  5. Connexins 36 and 45 may contribute to supporting Leydig cell steroidogenesis. PMID: 23458200
  6. This study suggests a critical role for Cx45 in regulating endothelial-induced mesenchymal cell differentiation towards a mural cell phenotype. PMID: 23220276
  7. Connexin45 modulates the proliferation of transit-amplifying precursor cells in the mouse subventricular zone. PMID: 23169657
  8. Cx45 is crucial for optimal impulse propagation in the atrioventricular node. Cardiomyocyte-directed deficiencies of Cx45 in mice result in embryonic lethality due to morphological and functional cardiovascular defects. PMID: 22982984
  9. Cx45 is physiologically expressed in vascular smooth muscle PMID: 22848755
  10. Cx45 strongly modulates the firing pattern of individual RGCs, ensuring strongly correlated firing between nearby RGCs and normal patterning of retinogeniculate projections. PMID: 21734291
  11. Data suggest that Cx45 is expressed on OFF bipolar cell dendrites, likely forming gap junctions with cells of the same type, and on OFF bipolar cell axon terminals, potentially forming heterologous gap junctions with other retinal neurons. PMID: 21192077
  12. Data suggest that Cx45 and Cx36 share similar functions in the retina, while Cx45 plays specific roles in the developing heart that cannot be compensated for by Cx36. PMID: 20930146
  13. Neuron-directed deletion of Cx45 impaired one-trial novel object recognition and altered kainate-induced gamma-oscillations, potentially through the disruption of inter-neuronal gap junctional communication in the hippocampus or perirhinal cortex. PMID: 20471991
  14. Data indicate that connexin 45 and ZO-1 directly interact in osteoblastic cells (ROS/Cx45) PMID: 12064590
  15. Cx40 knock-in Cx45 mice were generated to investigate the ability of Cx45 to replace Cx40 function in cardiac electrical conduction. PMID: 14630724
  16. Connexin45 is localized to vascular tissue of pancreatic islets. PMID: 14980497
  17. Connexin45 plays a role in the inner ear vascular system development PMID: 14986102
  18. Cx43 and Cx45 form homomeric-homotypic, homomeric-heterotypic channels, as well as heteromeric-homotypic and heteromeric-heterotypic channels. PMID: 15048573
  19. Expression of Cx45 is up-regulated during skeletal muscle regeneration. PMID: 15601660
  20. These data suggest that Cx45 participates in the formation of functional heterotypic electrical synapses between two types of retinal neurons that constitute the major rod pathway. PMID: 15659592
  21. Cx45 was found in some ON bipolar cells, but RT-PCR showed Cx36 and not Cx45 to be expressed by the bipolar cells. Some of the remaining GFP-negative bipolar cells expressed Cx45 but not Cx36. PMID: 16014731
  22. Connexin45 mediates gap junctional coupling of bistratified ganglion cells in the mouse retina. PMID: 16041717
  23. Increased myocardial expression of Cx45 results in remodeling of intercellular coupling and increased susceptibility to ventricular arrhythmias in vivo. PMID: 16126808
  24. These morphological data suggest that Connexin45 might play a modifying role in widely distributed, coupled neurons of the olivocerebellar system, but it is not essential for the creation of its neuronal gap junctions. PMID: 16435305
  25. Our findings provide direct evidence for heterotypic gap junctions composed of Cx45 between AII amacrine and certain types of ON cone bipolar cells. PMID: 17004931
  26. Cx45 was observed ubiquitously distributed throughout the retina in cells undergoing proliferation and differentiation, as well as in differentiated neurons. In the adult retina, this protein exhibited a more restricted distribution in both neurons and glial cells. PMID: 17029293
  27. Connexin45 is expressed in the juxtaglomerular apparatus and is involved in regulating renin secretion and blood pressure. PMID: 18579650
  28. CAR mediates Cnx45 localization in the murine heart. PMID: 18636119
  29. Increased expression in the failing ventricle contributes to decreased gap junction size. PMID: 18649189
  30. These data demonstrate that in Cx45-expressing neurons of IPL, Cx45 is almost always accompanied by Cx36, forming "bihomotypic" gap junctions, with Cx45 structurally coupling to Cx45 and Cx36 coupling to Cx36. PMID: 18815262
  31. The Cx45eGFP transgene could not rescue embryonic lethality of Cx45-deficient mice. PMID: 19473725

Show More

Hide All

Database Links
Protein Families
Connexin family, Gamma-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

Basic Research Questions

  • What is mouse Gjc1 and how does it compare to human GJC1?

Mouse Gjc1 (also known as Connexin-45 or Cx45) is a gap junction protein that forms intercellular channels allowing the diffusion of small molecules between adjacent cells. The mouse ortholog shares significant homology with human GJC1 (also called GJA7/Cx45).

The human GJC1 protein is encoded by the GJC1 gene, a member of the connexin gene family. It functions as a component of gap junctions, which provide routes for diffusion of low molecular weight materials (below 1-1.5 kDa) between cells, including ions, second messengers, amino acids, and metabolites .

Mouse Gjc1 (UniProt ID: P28229) and human GJC1 (UniProt ID: P36383) share conserved functional domains, particularly in the transmembrane and extracellular loop regions critical for channel formation . Both proteins contain four transmembrane domains with similar topology and are involved in cardiac function .

  • What are the optimal conditions for handling recombinant mouse Gjc1 protein?

For optimal handling of recombinant mouse Gjc1 protein:

  • Storage: Store at -20°C/-80°C. The shelf life is typically 6 months for liquid formulations and 12 months for lyophilized forms at these temperatures .

  • Reconstitution: Briefly centrifuge before opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C .

  • Stability: Repeated freezing and thawing is not recommended. Working aliquots can be stored at 4°C for up to one week .

  • Purity considerations: Commercially available recombinant proteins typically have >85% purity as verified by SDS-PAGE .

  • How can I verify the expression and localization of Gjc1 in mouse tissue samples?

To verify Gjc1 expression and localization in mouse tissue samples:

Immunohistochemistry/Immunofluorescence approach:

  • Fix tissue samples with 4% paraformaldehyde or 80% methanol (5 minutes).

  • Permeabilize with 0.1% PBS-Tween for 20 minutes.

  • Block with PBS containing 10% normal serum and 0.3M glycine to reduce non-specific interactions.

  • Incubate with primary antibodies specific to Gjc1/Cx45 (such as monoclonal antibodies) at appropriate concentrations (typically 1μg/1×10^6 cells) for 30 minutes at room temperature .

  • Apply fluorophore-conjugated secondary antibodies (e.g., DyLight® 488) at 1/500 dilution for 30 minutes.

  • Include appropriate isotype controls to verify specificity .

Co-localization studies:
Gjc1 often co-localizes with other connexins such as Gja1 (Cx43) at intercalated discs in cardiac tissue. Double immunostaining can reveal these interactions as shown in studies of human cardiac tissue .

  • What is the molecular structure of mouse Gjc1 and how does this influence its function?

Mouse Gjc1 is a 396 amino acid transmembrane protein with the following structural features:

  • Domains: Contains four transmembrane domains that anchor the protein in the cell membrane .

  • Topology: Features two extracellular loops that are critical for docking with connexins in adjacent cells and one cytoplasmic loop.

  • Functional elements: The N-terminal and C-terminal regions face the cytoplasm and contain regulatory sites for post-translational modifications.

The protein's structure directly influences its function in several ways:

  • Channel formation: Six connexin proteins assemble to form a connexon (hemichannel). When aligned with a connexon from an adjacent cell, they create a complete gap junction channel .

  • Selectivity and permeability: The pore size and amino acid composition determine which molecules can pass through the channel. Gjc1 channels typically allow passage of molecules up to 1-1.5 kDa, including ions (K+, Ca2+) and second messengers (IP3, cAMP) .

  • Regulation: The cytoplasmic domains contain sites for phosphorylation and other post-translational modifications that regulate channel opening, closing, and degradation .

Advanced Research Questions

  • How can I design experiments to investigate Gjc1 mutations associated with cardiac diseases?

To investigate Gjc1 mutations associated with cardiac diseases:

Step 1: Mutation identification and analysis

  • Conduct bioinformatic analysis of known Gjc1/GJC1 mutations using databases like ClinVar or gnomAD.

  • Apply domain distribution analysis to locate mutations in specific protein regions (transmembrane, extracellular loops, cytoplasmic regions) .

  • Utilize conservation analysis across species to identify critical residues .

Step 2: Functional characterization approaches

  • Site-directed mutagenesis: Generate recombinant mouse Gjc1 constructs with disease-associated mutations.

  • Electrophysiological analysis:

    • Dual whole-cell patch-clamp to measure gap junction conductance

    • Dye transfer assays to assess channel permeability to different molecules

    • These approaches have successfully characterized mutations in related connexins (GJA5/Cx40) associated with atrial fibrillation .

Step 3: In vivo models

  • Generate transgenic or knock-in mouse models expressing Gjc1 mutations.

  • Assess cardiac conduction using:

    • Electrocardiography (ECG)

    • Optical mapping

    • Intracardiac electrophysiology studies

Step 4: Molecular analyses

  • Examine protein trafficking using immunohistochemistry and confocal microscopy.

  • Assess protein-protein interactions with co-immunoprecipitation and proximity ligation assays.

  • Evaluate channel assembly using biochemical approaches like sucrose gradient centrifugation.

Studies of GJA1 (Cx43) mutations provide a methodological template, as shown in research on oculodentodigital dysplasia where mutations disrupt gap junction function through various mechanisms .

  • What techniques are most effective for studying heterotypic interactions between Gjc1 and other connexins?

For studying heterotypic interactions between Gjc1 and other connexins:

Cell-based systems:

  • Co-expression systems: Transfect cells with Gjc1 and another connexin (e.g., Cx43) in separate populations, then co-culture to allow formation of heterotypic channels .

  • Engineered connexin variants: Create chimeric or mutant connexins to identify critical residues for docking and channel function, as demonstrated in studies of Cx26/Cx43 heterotypic channels .

Functional assays:

  • Dual whole-cell patch clamp: Measure electrical coupling between cells expressing different connexins.

  • Dye transfer selectivity: Use gap junction-permeable dyes of different sizes and charges to evaluate permeability characteristics:

    • Lucifer Yellow (MW 457 Da, -2 charge)

    • Neurobiotin (MW 323 Da, +1 charge)

    • Propidium iodide (MW 668 Da, +2 charge)

Molecular docking analyses:

  • Structure-based analysis: Use homology modeling and molecular dynamics simulations to predict docking interfaces, as has been done with Cx32/Cx26 interactions where asparagine 175 was identified as a critical residue for heterotypic docking .

  • Mutagenesis validation: Test predictions by mutating specific residues in the extracellular loops.

Assay TypeApplicationAdvantagesLimitations
Dye TransferFunctional permeabilityDirect measurement of molecular exchangeLimited to fluorescent molecules
ElectrophysiologyElectrical couplingHigh sensitivity to channel openingTechnical complexity
FRETProtein proximityCan detect pre-docking interactionsRequires fluorescent tags
Co-IPProtein-protein bindingIdentifies stable interactionsMay miss transient interactions

Research has shown that specific extracellular loop residues are crucial for compatibility between different connexins in heterotypic channels, with mutations potentially altering selectivity and conductance .

  • How does Gjc1 function differ in various cardiac cell types and what methods best characterize these differences?

Gjc1 exhibits cell type-specific functions in the cardiac conduction system:

Cell type-specific expression patterns:

  • Sinoatrial node (SAN): Gjc1 is highly expressed in mouse SAN cells, contributing to the unique electrophysiological properties of pacemaker cells.

  • Atrioventricular node (AVN): Gjc1 expression is essential for proper conduction delay at the AVN.

  • Working myocardium: Gjc1 is expressed at lower levels but forms heterotypic channels with Gja1 (Cx43).

Methods to characterize cell type-specific functions:

  • Conditional knockout models: Using Cre-loxP system with cell type-specific promoters:

    • HCN4-CreERT2 for SAN-specific deletion

    • Tbx3-Cre for AVN-specific deletion

    • αMHC-Cre for working myocardium

  • Electrophysiological approaches:

    • Isolated heart preparations with optical mapping

    • Patch clamp recordings from isolated cardiomyocytes

    • Multi-electrode arrays for field potential recordings

  • Single-cell RNA sequencing: To characterize Gjc1 expression levels across cardiac cell populations.

  • Cell type-specific proteomics: To identify Gjc1 interaction partners unique to each cardiac cell type.

Recent research has shown that GJC1 mutations can cause congenital heart disease and arrhythmias, mapping to chromosome 17q21.31-q21.33 in humans . A study demonstrated that GJB4 (another connexin) co-localizes with GJA1 in diseased hearts, suggesting complex connexin interactions in cardiac pathology .

  • What are the most effective approaches for studying the phosphorylation status of Gjc1 and its impact on channel gating?

To study Gjc1 phosphorylation and its impact on channel gating:

Identification of phosphorylation sites:

  • Mass spectrometry approaches:

    • Immunoprecipitate Gjc1 from mouse tissue/cells

    • Perform phosphoproteomic analysis using tandem mass spectrometry

    • Map identified phosphopeptides to the Gjc1 sequence

  • Phospho-specific antibodies:

    • Develop antibodies against predicted phosphorylation sites

    • Validate using phosphatase treatments and site-directed mutagenesis

Functional characterization:

  • Phosphomimetic mutants:

    • Replace phosphorylatable serine/threonine residues with aspartate/glutamate to mimic phosphorylation

    • Replace with alanine to prevent phosphorylation

    • Express in communication-deficient cell lines

  • Electrophysiological assessment:

    • Single channel recordings to measure open probability and conductance states

    • Voltage-clamp studies to assess voltage-dependent gating

    • Determine changes in ionic selectivity

  • Kinase/phosphatase manipulation:

    • Apply specific kinase activators or inhibitors (PKA, PKC, MAPK)

    • Use phosphatase inhibitors (okadaic acid, calyculin A)

    • Measure acute effects on channel function

Studies on other connexins have shown that phosphorylation can regulate trafficking, assembly, gating, and degradation. For example, Cx43 phosphorylation by casein kinase 1 promotes gap junction assembly, while PKC-mediated phosphorylation can decrease channel conductance . Similar approaches can be applied to Gjc1.

  • How can I differentiate between hemichannel and gap junction activities when studying Gjc1 function?

Differentiating between hemichannel and gap junction activities of Gjc1 requires specific experimental approaches:

Hemichannel activity assessment:

  • Low calcium conditions: Hemichannels open in low extracellular calcium (0.2 mM or below). Perform experiments in calcium-free medium to promote hemichannel opening.

  • Dye uptake assays: Use membrane-impermeable fluorescent dyes that can enter cells via hemichannels:

    • Ethidium bromide (MW 394 Da)

    • Propidium iodide (MW 668 Da)

    • Measure fluorescence increase in individual cells over time

  • Electrophysiological methods:

    • Whole-cell patch clamp to measure hemichannel currents

    • Use hemichannel blockers (carbenoxolone, La³⁺, flufenamic acid) to confirm specificity

Gap junction activity assessment:

  • Dual cell patch clamp: Directly measure electrical coupling between adjacent cells

  • Dye transfer assays: Inject tracer dyes into one cell and monitor spread to adjacent cells:

    • Microinjection of Lucifer Yellow

    • Scrape-loading technique

    • Gap-FRAP (Fluorescence Recovery After Photobleaching)

  • Specific inhibitors: Use peptides mimicking connexin extracellular loops to block gap junction channels but not hemichannels

Controls to distinguish activities:

  • Cell density manipulation: Hemichannel activity is observed in sparse cultures; gap junction activity requires cell-cell contact

  • Connexin-mimetic peptides: Gap27 disrupts gap junctions but has delayed effects on hemichannels

Research on pannexins (which only form hemichannels, not gap junctions) has established that pannexins are glycoproteins with distinct characteristics from connexins, providing a useful comparative system .

  • What are the most robust approaches for studying Gjc1 trafficking and life cycle in cardiomyocytes?

For studying Gjc1 trafficking and life cycle in cardiomyocytes:

Protein synthesis and trafficking:

  • Pulse-chase experiments:

    • Label newly synthesized proteins with radioactive amino acids or click chemistry

    • Track their movement through cellular compartments over time

  • Live-cell imaging:

    • Generate Gjc1-fluorescent protein fusions (GFP, mCherry)

    • Use RUSH system (Retention Using Selective Hooks) to synchronize protein release from ER

    • Perform time-lapse confocal microscopy to track movement

  • Organelle markers:

    • Co-label with markers for ER (calnexin), Golgi (GM130), and plasma membrane

    • Quantify colocalization at different time points

Gap junction assembly and stability:

  • FRAP (Fluorescence Recovery After Photobleaching):

    • Bleach Gjc1-GFP at gap junction plaques

    • Measure fluorescence recovery to determine mobile fraction and half-time

    • Compare wild-type vs. mutant proteins

  • Triton solubility assays:

    • Extract cells with 1% Triton X-100

    • Gap junction plaques remain in insoluble fraction

    • Quantify distribution by Western blot

  • Super-resolution microscopy:

    • STORM or PALM imaging to visualize gap junction assembly at nanoscale resolution

    • Track connexon arrangement within plaques

Degradation pathways:

  • Inhibitor studies:

    • Lysosomal inhibitors (bafilomycin A1, chloroquine)

    • Proteasomal inhibitors (MG132, lactacystin)

    • Autophagy inhibitors (3-methyladenine)

  • Ubiquitination analysis:

    • Immunoprecipitate Gjc1 and probe for ubiquitin

    • Use mass spectrometry to identify ubiquitination sites

Research on other connexins has demonstrated that connexin trafficking follows the conventional secretory pathway, with quality control in the ER, oligomerization in the ER/Golgi, and transport to the plasma membrane via microtubules. Gjc1 is likely to follow similar pathways with protein-specific variations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.