Recombinant Mouse Gastrin-releasing peptide receptor (Grpr)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse GRPR

Recombinant mouse GRPR is a glycosylated, 7-transmembrane GPCR expressed in heterologous systems (e.g., baculovirus-infected insect cells, mammalian cell lines) for biochemical and pharmacological studies . Key features include:

  • Ligand specificity: Binds gastrin-releasing peptide (GRP) and bombesin (Bn) with high affinity (EC₅₀ ≈ 3.5 nM for GRP in functional assays) .

  • Signaling pathway: Activates phospholipase C (PLC) via Gαq coupling, leading to intracellular calcium mobilization .

  • Pathological relevance: Aberrantly expressed in cancers (prostate, lung, colon) and implicated in non-histaminergic itch .

2.1. Receptor Architecture

  • Domains:

    • Extracellular: N-terminal domain and three extracellular loops (ECLs) critical for ligand binding .

    • Transmembrane (TM): TM6 and TM7 undergo conformational shifts during activation .

    • Intracellular: C-terminal tail interacts with G proteins and β-arrestin .

  • Key residues:

    • Asp⁴⁹ (TM2) and Arg³⁴⁹ (TM7) stabilize ligand interactions .

    • His²⁹⁰ (TM6) and Phe³⁰³ (ECL3) mediate agonist-induced activation .

2.2. Ligand Binding Data

LigandAffinity (Kd/EC₅₀)Receptor CouplingSource
GRP3.5 nMGαqBenya et al.
Bombesin1.4 nMGαqPNAS
PD176252 (antagonist)60 nMGαq inhibitionPMC

Expression Systems and Reconstitution

Recombinant mGRPR has been expressed in:

  • Mouse fibroblasts: Achieved ~10⁶ receptors/cell for functional assays .

  • Baculovirus/Sf9 cells: Used for structural studies (cryo-EM and crystallography) .

Reconstitution methodology:

  1. Urea extraction: Removes endogenous G proteins while preserving receptor integrity .

  2. G protein addition: Purified Gαq and Gβγ subunits restore agonist-dependent GTPγS binding .

4.1. G Protein Selectivity

  • Gαq coupling: Agonist-dependent GTPγS binding (Km = 90 nM for squid Gαq) .

  • No coupling to Gαi/o or Gαt: Demonstrated via reconstitution assays .

4.2. Cancer Research Applications

  • Prostate cancer (Ace-1-huGRPr model):

    • GRPR activation increases tumor growth and invasiveness via EMT upregulation .

    • BBN (GRPR agonist) enhances subcutaneous tumor growth in nude mice .

Role in Central Nervous System (CNS)

  • Neuronal signaling: Regulates emotional responses, social behavior, and memory .

  • Pathology:

    • Overexpressed in gliomas, driving proliferation via PI3K and cAMP/PKA pathways .

    • Linked to autism and itch disorders .

Therapeutic Implications

  • Cancer targeting: GRPR antagonists (e.g., PD176252) inhibit tumor growth in preclinical models .

  • Itch modulation: Blocking GRPR reduces non-histaminergic pruritus in mice .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Grpr; Gastrin-releasing peptide receptor; GRP-R; GRP-preferring bombesin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAPNNCSHLNLDVDPFLSCNDTFNQSLSPPKMDNWFHPGFIYVIPAVYGLIIVIGLIGNI TLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFI QLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFS DLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLAIISVYYYFIARNLIQ SAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSML HFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLMNRSHSTGRSTTCMT SFKSTNPSATFSLINRNICHEGYV
Uniprot No.

Target Background

Function
The gastrin-releasing peptide receptor (GRPR) is a receptor for gastrin-releasing peptide (GRP). It signals through G protein-coupled pathways, activating a phosphatidylinositol-calcium second messenger system and resulting in Akt phosphorylation. GRPR contributes to the regulation of food intake, the perception and transmission of pruritic stimuli (itch) in the spinal cord, and long-term fear memory formation. However, it does not appear to play a role in pain perception or normal spatial memory. Its primary role appears to be in non-histaminergic itch sensation.
Gene References Into Functions
  1. GRP/GRPR pathway activation in fibroblast-like synoviocytes (FLS) promotes invasion, at least partly through AKT activation, suggesting potential therapeutic targets for rheumatoid arthritis. PMID: 28733141
  2. Ablation of GRPR-expressing neurons eliminated sighing induced by hypoxia and baseline conditions, without initially affecting other aspects of breathing. PMID: 26855425
  3. NMBR and GRPR exhibit distinct roles in itch transmission and interact with specific interneuron populations in itch signaling. PMID: 25209280
  4. BNP-NPRA signaling affects both itch and pain independently of the GRP-GRPR neuronal pathway. PMID: 24438367
  5. Spinal neurons expressing the BB2 receptor transmit herpes-associated itch through BB2 receptor-independent signaling. PMID: 23778077
  6. Spinal GRPR and NMBr independently mediate itch neurotransmission in mice. PMID: 23826298
  7. GRPR and stathmin oppositely regulate cued fear extinction and neuronal activity in the amygdala and prefrontal cortex. PMID: 22312434
  8. GRPR mediates neutrophil chemotaxis and may contribute to inflammatory disorders. PMID: 22203955
  9. Opioid-induced itch involves GRPR signaling through MOR1D heterodimerization, independent of opioid analgesia. PMID: 22000021
  10. GRPR deletion induces depression-like behavior, potentially linked to amygdala gene dysregulation and deficient light-induced corticosterone release. PMID: 21254899
  11. GRPR does not appear to significantly affect risk assessment behavior or conventional anxiety parameters. PMID: 11803457
  12. GRP/GRPR plays a transient and minor role in intestinal development. PMID: 11960700
  13. GRPR is involved in fear regulation and memory in the mouse amygdala. PMID: 12526815
  14. GRPR gene expression is predominantly observed during lung development in utero. PMID: 12959933
  15. MCH is enhanced in BRS-3-deficient mice but not in GRP-R-deficient mice. PMID: 14988239
  16. GRPR immunoreactivity is found in the amygdala and NTS, regions crucial for memory. PMID: 15680955
  17. Changes in GRPR are light-driven and impact SCN signaling involved in circadian rhythm entrainment. PMID: 16519669
  18. GRPR may be a key mediator of itch sensation in the spinal cord dorsal horn. PMID: 17653196
  19. Bombesin/GRP significantly affects articular chondrocytes and inflammation. PMID: 17911468
  20. GRP and GRPR exhibit oncogenic properties beyond their known mitogenic roles. PMID: 18753628
Database Links

KEGG: mmu:14829

STRING: 10090.ENSMUSP00000033730

UniGene: Mm.4687

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in pancreas and brain. Detected in suprachaismatic nucleus neurons. Detected in neurons in the dorsal horn of the spinal cord. Detected in inhibitory GABAergic interneurons in the lateral nucleus of the amygdala.

Q&A

What is the Gastrin-releasing peptide receptor (Grpr) and what are its primary functions?

Gastrin-releasing peptide receptor (Grpr) is a glycosylated, 7-transmembrane G-protein coupled receptor that mediates the effects of gastrin-releasing peptide (GRP) and bombesin (Bn). This receptor activates the phospholipase C signaling pathway upon ligand binding . Grpr regulates numerous critical physiological functions in both the gastrointestinal system and central nervous system.

In mammals, Grpr mediates several biological responses including:

  • Secretion of gastrointestinal hormones (gastrin, neurotensin, cholecystokinin, somatostatin, and enteroglucagon)

  • Regulation of smooth muscle contractility

  • Modulation of neuronal activity

  • Growth regulation of normal and neoplastic tissues

Within the central nervous system, Grpr plays important roles in:

  • Regulation of homeostasis

  • Thermoregulation

  • Metabolism

  • Behavior

The receptor is of particular research interest because it is aberrantly expressed in numerous cancers including lung, colon, and prostate cancers .

How does Grpr signaling work at the molecular level?

Grpr functions through selective coupling with specific G proteins, primarily Gαq. When an agonist such as GRP or bombesin binds to the receptor, it catalyzes the exchange of GDP for GTP on the Gα subunit. This process requires the presence of Gβγ subunits for optimal activation .

Experimental reconstitution studies have demonstrated that:

  • Receptor-catalyzed binding of GTPγS to Gαq is dependent on both agonist (GRP) and Gβγ subunits

  • The EC50 for GRP in this process is approximately 3.5 nM, correlating well with the reported Kd of 3.1 nM for GRP binding to Grpr expressed in mouse fibroblasts

  • The apparent Kd for bovine brain Gβγ in this reconstitution assay is around 60 nM

Importantly, research has shown that Grpr does not functionally couple to pertussis toxin-sensitive G proteins like Gαi/o or Gαt, highlighting the selective nature of its G protein coupling .

What are the optimal expression systems for producing recombinant mouse Grpr?

For successful recombinant mouse Grpr expression, several systems have been employed with varying advantages for different research purposes:

Basic methodology (Mammalian cell expression):
Mammalian expression systems, particularly mouse fibroblast cell lines (such as Balb 3T3), have proven highly effective for expressing functional mouse Grpr. These systems offer proper post-translational modifications and protein folding essential for receptor functionality .

Advanced methodology (Alternative expression systems):
For specialized research applications, other expression systems can be utilized:

  • HEK293 cells: Widely used for G-protein coupled receptor expression due to their high transfection efficiency and human-derived post-translational modification patterns

  • E. coli systems: While challenging for full-length receptor expression due to the hydrophobic nature of transmembrane domains, these systems can be valuable for expressing receptor fragments for structural studies

  • Wheat germ cell-free systems: Useful for producing receptor proteins that may be toxic to living cells

The choice of expression system should be dictated by the specific research application, with consideration given to required post-translational modifications, protein yield, and functional integrity of the receptor.

What purification strategies are most effective for recombinant mouse Grpr preparations?

Basic methodology:
For preparing membrane fractions containing functional Grpr, researchers can employ a modified urea extraction protocol:

  • Generate a P2 membrane pellet from cells expressing recombinant Grpr

  • Treat membranes with agonist (100 nM bombesin or GRP for 30 minutes at 25°C) to drive dissociation of any G proteins interacting with Grpr

  • Extract membranes with 6 M urea to remove endogenous G proteins

  • This produces membranes containing functional, but uncoupled, Grpr in a native phospholipid environment

Advanced methodology:
For more specialized applications requiring purified receptor:

  • Add epitope tags (such as His, T7, GST, Avi, or Fc) to facilitate affinity purification

  • Use detergent solubilization (typically with mild detergents like DDM or LMNG)

  • Employ affinity chromatography followed by size exclusion chromatography

  • Reconstitute purified receptor into nanodiscs or liposomes for functional studies

The urea extraction method particularly yields membrane preparations with binding affinities of 0.9-1.5 nM (Kd, n = 3) and a binding capacity of 15-22 pmol of receptor per mg of protein, representing a 2-3 fold enrichment compared to untreated membranes .

How can the functionality of recombinant mouse Grpr be assessed in vitro?

Basic assessment methods:

  • Ligand binding assays: Using radioiodinated ligands like 125I-[Tyr4]bombesin to determine binding affinity and receptor density. Quantitative ligand displacement analysis with various unlabeled Grpr agonists should show the characteristic rank order of potency: bombesin ≥ GRP ≫ neuromedin B

  • G protein coupling assays: Measuring receptor-catalyzed GDP/GTP exchange on G proteins, particularly Gαq

Advanced assessment methods:

  • In situ reconstitution assay: This sophisticated approach directly measures the first event in G protein activation - receptor-catalyzed exchange of GTP for GDP on the Gα subunit. The protocol involves:

    • Reconstituting urea-extracted membranes containing Grpr with purified Gα and Gβγ subunits

    • Measuring GTPγS binding in the presence and absence of agonist

    • Analyzing Gβγ dependence of receptor-catalyzed nucleotide exchange

  • Calcium mobilization assays: Since Grpr activates the phospholipase C pathway leading to calcium release, fluorescent calcium indicators can be used to monitor receptor activation in real-time

  • Phospholipase C activation: Measuring inositol phosphate production following receptor stimulation

What experimental controls are essential when working with recombinant mouse Grpr?

When conducting experiments with recombinant mouse Grpr, several critical controls should be included:

Basic controls:

  • Untransfected cells: To establish baseline responses and rule out endogenous receptor effects

  • Antagonist controls: Using specific Grpr antagonists to confirm receptor specificity

  • Negative control ligands: Testing structurally related peptides that don't activate Grpr

Advanced controls:

  • G protein selectivity controls: Include tests with multiple G protein subtypes (e.g., Gαq, Gαi/o, Gαt) to confirm coupling specificity. Research has demonstrated that while Grpr can catalyze GDP/GTP exchange on Gαq, it cannot functionally couple to pertussis toxin-sensitive G proteins like Gαi/o or Gαt, even at concentrations up to 1 μM

  • Agonist-dependency controls: Include conditions with and without agonist to confirm agonist-dependent activation. For reconstitution experiments, controls have shown that Grpr-catalyzed exchange of GDP for GTPγS on Gαq is dependent on both agonist and the presence of Gβγ subunits

  • Receptor saturation controls: To establish appropriate ligand concentrations. GRP saturation of Grpr-catalyzed GDP/GTPγS exchange on Gαq typically conforms to a single-site model with a K0.5 of 3.5 nM, which agrees with the reported Kd of 3.1 ± 1.4 nM for Grpr expressed in Balb 3T3 cells

How is recombinant mouse Grpr utilized in cancer research models?

Gastrin-releasing peptide receptor has emerged as an important target in cancer research due to its aberrant expression in numerous malignancies including lung, colon, and prostate cancers .

Basic applications:

  • Expression profiling: Comparing Grpr expression levels between normal and cancerous tissues to assess its potential as a biomarker

  • Functional studies: Investigating the role of Grpr signaling in cancer cell proliferation, migration, and invasion

Advanced applications:

  • Theranostic development: Recombinant mouse Grpr serves as a critical tool in the development and validation of Grpr-targeted theranostics for cancer management. This approach combines therapeutic and diagnostic capabilities in a single agent

  • Preclinical testing pipeline: Using recombinant mouse Grpr for:

    • In vitro studies investigating tumor uptake

    • Antitumor efficacy assessment

    • Biodistribution studies

    • Pharmacokinetic profiling

    • Dosimetry calculations

    • Toxicological evaluation

  • Comparative oncology models: Mouse models expressing recombinant Grpr allow for comparative studies between human and mouse systems, facilitating translation of findings from bench to bedside

What are the technical challenges in developing Grpr-targeted cancer therapeutics?

Basic challenges:

  • Receptor specificity: Ensuring therapeutic agents selectively target Grpr without affecting related receptors

  • Expression heterogeneity: Accounting for variable Grpr expression levels across different tumor types and even within the same tumor

Advanced challenges:

  • Peptide stability: GRP and bombesin-based targeting ligands may have limited in vivo stability, requiring chemical modifications or alternative delivery systems

  • Biodistribution optimization: Balancing tumor uptake against normal tissue binding, particularly in tissues with physiological Grpr expression

  • Pharmacokinetic considerations: Developing agents with appropriate clearance rates for either diagnostic imaging or therapeutic applications

The development of Grpr-targeted theranostics for cancer management involves a complex pipeline that must address these challenges through systematic preclinical validation before clinical translation .

What methodologies are used to study Grpr-ligand interactions at the molecular level?

Understanding the molecular details of how gastrin-releasing peptide receptor interacts with its ligands is crucial for drug development and basic mechanistic studies.

Basic methodologies:

  • Competitive binding assays: Using radioligands to determine binding affinities of various ligands

  • Functional response measurements: Assessing downstream signaling events after receptor activation

Advanced methodologies:

  • Receptor reconstitution systems: The in situ receptor reconstitution assay allows detailed characterization of receptor-G protein coupling specificity and receptor pharmacology. This system has shown:

    • Uncoupled receptors exhibit decreased affinity for agonists while antagonist affinity remains unaffected

    • Reconstitution with appropriate G proteins restores high-affinity agonist binding

    • The system enables identification and characterization of receptor inverse agonists

  • Molecular modeling and structure-based approaches: Though not explicitly mentioned in the search results, these approaches are complementary to experimental methods for understanding Grpr-ligand interactions

  • Mutational analysis: Site-directed mutagenesis of key Grpr residues to identify those critical for ligand binding and receptor activation

How does the ligand binding profile of recombinant mouse Grpr compare to the human receptor?

Basic comparison:
Both mouse and human gastrin-releasing peptide receptors bind to the same endogenous ligands, with bombesin and GRP showing high affinity binding, while neuromedin B exhibits lower affinity .

Advanced comparison:
The binding profile of mouse Grpr shows that:

  • The rank order of potency for mouse Grpr is: bombesin ≥ GRP ≫ neuromedin B

  • This pharmacological profile is characteristic of the GRP-preferring subtype of bombesin receptors

  • Mouse Grpr expressed in fibroblasts exhibits a Kd of approximately 3.1 nM for GRP binding

While the search results don't provide direct comparative data between mouse and human receptors, this information serves as a baseline for researchers conducting comparative studies between species, which is essential for translational research.

What are common issues in recombinant mouse Grpr expression and how can they be addressed?

Basic issues and solutions:

  • Low expression levels:

    • Optimize codon usage for the expression system

    • Use strong promoters appropriate for the expression system

    • Consider using cell lines specifically designed for GPCR expression

  • Receptor misfolding:

    • Adjust growth temperature (often lower temperatures improve folding)

    • Add chemical chaperones to the culture medium

    • Include stabilizing agents during membrane preparation

Advanced issues and solutions:

  • Uncoupling from signaling pathways:

    • The research demonstrates that treating membranes with agonist before urea extraction is critical for generating a pure population of uncoupled receptors. Without this step, urea extraction alone does not produce membranes with receptor functionally uncoupled from G proteins

  • Endogenous GTP-binding activity interference:

    • The presence of endogenous GTP-binding proteins can mask the measurement of receptor-catalyzed nucleotide exchange on exogenously added G proteins

    • Urea extraction (6M) dramatically decreases endogenous GTP binding, allowing for cleaner experimental results

  • Maintaining receptor in native conformation:

    • Use epitope-tagged receptor constructs that preserve wild-type function. For example, a mouse Grpr cDNA containing 11 amino acid residues of the c-myc gene added to the amino terminus exhibits characteristics indistinguishable from wild-type Grpr when assayed for ligand binding, PLC activation, internalization, and desensitization

How can G protein coupling specificity be determined experimentally?

Basic approach:
Measure receptor-mediated activation of different G protein subtypes using standard second messenger assays (cAMP, inositol phosphates, etc.)

Advanced methodologies:
The in situ reconstitution assay provides a powerful tool for directly assessing G protein coupling specificity:

  • Step-by-step methodology:

    • Prepare urea-extracted membranes containing recombinant Grpr

    • Reconstitute with purified G protein subunits (Gα and Gβγ)

    • Measure receptor-catalyzed GDP/GTP exchange on various Gα subunits

    • Compare the ability of the receptor to activate different G protein subtypes

  • Experimental evidence of coupling selectivity:

    • Research has demonstrated that Grpr selectively couples to Gαq

    • Even at G protein concentrations of 1 μM, Grpr cannot catalyze nucleotide exchange on Gαi/o or Gαt

    • This selectivity is observed despite previous reports suggesting potential coupling to pertussis toxin-sensitive G proteins based on indirect evidence

  • Resolving contradictory findings:

    • The direct measurement of receptor-catalyzed GDP/GTP exchange has clarified that previous observations of pertussis toxin sensitivity in Grpr signaling pathways likely resulted from indirect mechanisms

    • Possible explanations include:
      a) Physical but non-productive interactions between Grpr and Gαi/o
      b) PTX-mediated prevention of Gα and Gβγ subunit dissociation affecting the cellular concentration of free Gβγ subunits, which are critical for Grpr activation of Gαq

These advanced methodologies have resolved longstanding questions about the specificity of Grpr coupling to G proteins, demonstrating the value of direct measurement approaches in receptor characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.