Recombinant Mouse Ghrelin O-acyltransferase (Mboat4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Mboat4; Gm171; Goat; Ghrelin O-acyltransferase; Membrane-bound O-acyltransferase domain-containing protein 4; O-acyltransferase domain-containing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-435
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Mboat4
Target Protein Sequence
MDWLQLFFLHPLSFYQGAAFPFALLFNYLCILDTFSTRARYLFLLAGGGVLAFAAMGPYS LLIFIPALCAVALVSFLSPQEVHRLTFFFQMGWQTLCHLGLHYTEYYLGEPPPVRFYITL SSLMLLTQRVTSLSLDICEGKVEAPRRGIRSKSSFSEHLWDALPHFSYLLFFPALLGGSL CSFRRFQACVQRSSSLYPSISFRALTWRGLQILGLECLKVALRSAVSAGAGLDDCQRLEC IYLMWSTAWLFKLTYYSHWILDDSLLHAAGFGAEAGQGPGEEGYVPDVDIWTLETTHRIS LFARQWNRSTALWLRRLVFRKSRRWPLLQTFAFSAWWHGLHPGQVFGFLCWSVMVKADYL IHTFANVCIRSWPLRLLYRALTWAHTQLIIAYIMLAVEGRSLSSLCQLCCSYNSLFPVMY GLLLFLLAERKDKRN
Uniprot No.

Target Background

Function
This recombinant Mouse Ghrelin O-acyltransferase (GOAT, also known as MBOAT4) mediates the octanoylation of ghrelin at Serine 3. It utilizes a variety of fatty acids as substrates, including octanoic acid, decanoic acid, and tetradecanoic acid.
Gene References Into Functions

Selected Research Highlights on GOAT Function:

  1. In vitro investigation of GOAT's impact on gastric acid secretion and ghrelin expression. PMID: 29966658
  2. GOAT immunoreactivity in the dentate granule cell layer of wild-type mice, its dependence on GHSR1a expression, and independence from ghrelin levels. PMID: 29063591
  3. Localization of ghrelin and GOAT in the spleen and thymus, suggesting distinct roles in immune regulation and obesity-induced inflammation. PMID: 28368434
  4. Anxiogenic effects of GOAT deletion, independent of des-acyl ghrelin levels. PMID: 27490185
  5. Increased hypoglycemia susceptibility in GOAT knockout pregnant mice on calorie-restricted diets. PMID: 27701682
  6. The role of Bmal1 in the circadian rhythmicity of ghrelin signaling and its regulation by a food-responsive clock in gastric ghrelin-secreting cells. PMID: 26576661
  7. Impact of GOAT loss on growth hormone release and patterning. PMID: 26442444
  8. Altered lipid and salt taste responsiveness in ghrelin and GOAT null mice. PMID: 24124572
  9. The lack of influence of GOAT absence on glucose intolerance. PMID: 23630616
  10. Irrelevance of GOAT in maintaining body temperature and metabolic adaptation during cold exposure. PMID: 22526011
  11. Regulation of hedonic feeding by GOAT-induced ghrelin acylation. PMID: 22982020
  12. Non-essential role of the GOAT-ghrelin-growth hormone secretagogue receptor system in maintaining euglycemia during prolonged calorie restriction. PMID: 22363801
  13. Review: Unique tissue expression of GOAT suggests potential acylation of additional peptides. PMID: 21600256
  14. GOAT's novel role in regulating intestinal bile acid reabsorption. PMID: 21965605
  15. Essential role of GOAT in growth hormone-mediated survival of calorie-restricted mice. PMID: 20231469
  16. Correlation between stomach GOAT mRNA levels and circulating acylated-ghrelin levels in mice. PMID: 20035826
  17. Potential species differences in gastric GOAT expression between rats and mice. PMID: 20059966
  18. Requirement of PC, GOAT, and n-octanoic acid for n-octanoyl ghrelin production. PMID: 19628676
  19. Identification of GOAT as a polytopic membrane-bound enzyme responsible for octanoate attachment to ghrelin. PMID: 18267071
  20. Characterization of human GOAT. PMID: 18443287
  21. GOAT's highly enriched expression in gastric ghrelin cells and its distribution mirroring that of ghrelin. PMID: 19401456
  22. GOAT mRNA expression in murine cartilage explants and ATDC-5 cells. PMID: 19479831
  23. Identification of a four-amino acid core motif for GOAT substrate recognition. PMID: 19501572
  24. The ghrelin-GOAT system as a signaling pathway for dietary calorie detection. PMID: 19503064
Database Links
Protein Families
Membrane-bound acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in stomach. Lower expression in small intestine and colon. Very low expression in testis.

Q&A

What is Mouse Ghrelin O-acyltransferase (Mboat4) and what is its primary function?

Mouse Ghrelin O-acyltransferase (Mboat4) is a membrane-bound enzyme belonging to the MBOAT family that catalyzes the attachment of an eight-carbon fatty acid (octanoyl) to the Ser3 side chain of the peptide hormone ghrelin. This post-translational modification is essential for converting ghrelin to its active form, enabling it to bind to the growth hormone secretagogue receptor (GHSR1a) and regulate various metabolic processes including appetite stimulation, energy homeostasis, and glucose metabolism .

MBOAT family enzymes share common structural features including multiple transmembrane domains and conserved histidine and asparagine residues that are critical for catalytic activity. Mboat4 specifically falls into the subset of MBOATs that catalyze acylation of proteins or peptides, along with Porcupine (PORCN) and Hedgehog acyltransferase (HHAT) .

How does recombinant Mouse Mboat4 differ from native Mboat4 in functional assays?

Recombinant Mouse Mboat4 and native Mboat4 exhibit comparable catalytic activities in vitro, but several methodological considerations must be addressed when conducting functional assays. Recombinant Mboat4 is typically expressed with epitope tags (such as a C-terminal 3xFlag tag) to facilitate purification and detection, which may subtly alter enzyme kinetics in some experimental contexts .

What are the optimal expression systems for producing functional recombinant Mouse Mboat4?

The optimal expression systems for producing functional recombinant Mouse Mboat4 are mammalian cell lines, particularly HEK293T variants. The most effective approach involves:

  • Transfection of HEK293T GnTI- cells with mouse GOAT containing a C-terminal 3xFlag tag cloned into a mammalian expression vector with a CAG promoter

  • Preparation of microsomes through differential centrifugation

  • Verification of expression through Western blotting targeting the epitope tag

  • Validation of enzymatic activity using synthetic ghrelin substrates tagged with C-terminal biotin (e.g., Ghrelin27-Biotin)

This mammalian expression system is preferred over bacterial or insect cell systems because it provides the appropriate membrane environment and post-translational processing machinery for proper folding and integration of this multi-pass transmembrane protein. Researchers should note that expression conditions, including temperature, transfection reagents, and cell density, can significantly impact the yield and activity of the recombinant enzyme .

What are the most reliable methods for measuring recombinant Mouse Mboat4 activity in vitro?

The most reliable methods for measuring recombinant Mouse Mboat4 activity in vitro utilize microsomal preparations combined with synthetic peptide substrates and detection of the acylated product. A robust protocol includes:

  • Preparation of microsomal fractions containing recombinant Mboat4 from transfected HEK293T cells

  • Incubation of microsomes with synthetic ghrelin peptides (preferably biotinylated at the C-terminus) and octanoyl-CoA as the acyl donor

  • Capture of biotinylated reaction products using streptavidin-coated surfaces

  • Detection of octanoylated peptides through mass spectrometry or immunological methods with antibodies specific to the octanoyl modification

This approach allows for quantitative assessment of Mboat4 activity under controlled conditions. Important parameters to optimize include reaction temperature (typically 37°C), pH (optimal range 7.0-7.5), detergent concentration (to solubilize membranes without denaturing the enzyme), and incubation time .

How can researchers effectively solubilize and purify mouse Mboat4 while maintaining its activity?

Effective solubilization and purification of mouse Mboat4 while maintaining activity requires careful selection of detergents and buffer conditions. A methodological approach includes:

  • Solubilization of microsomes using mild detergents such as CHAPS, digitonin, or DDM at concentrations just above their critical micelle concentration

  • Addition of lipids (phosphatidylcholine, phosphatidylethanolamine) to stabilize the enzyme during extraction

  • Purification via affinity chromatography targeting the epitope tag (e.g., anti-Flag resin)

  • Buffer exchange to remove excess detergent while maintaining a minimal concentration necessary for solubility

  • Reconstitution into artificial membrane systems (liposomes or nanodiscs) for functional studies

This area has seen recent advances through new solubilization approaches coupled with computational modeling, crystallography, and cryoelectron microscopy. Researchers should note that complete purification often results in activity loss, so partial purification approaches that maintain the native membrane environment are sometimes preferable for activity studies .

What substrate specificity assays best characterize recombinant Mouse Mboat4 in research settings?

The most informative substrate specificity assays for characterizing recombinant Mouse Mboat4 employ a panel of peptide substrates with systematic variations in amino acid sequence, combined with a range of acyl-CoA donors. A comprehensive approach includes:

  • Testing truncated ghrelin peptides (e.g., pentapeptides containing the essential Ser3 residue) to determine minimal substrate requirements

  • Systematic mutation of amino acids flanking the acylation site to establish sequence determinants

  • Evaluation of various acyl-CoA donors (varying in chain length from C4 to C16) to define acyl chain specificity

  • Kinetic analysis (Km and Vmax determination) for each substrate variant to quantify preference

Research has demonstrated that truncated ghrelin pentapeptides can be acylated by microsomal GOAT, although they typically show weaker apparent affinity for the enzyme compared to full-length ghrelin . This methodological approach enables precise characterization of substrate recognition determinants, essential for understanding the molecular basis of Mboat4 specificity.

How do recent structural studies of MBOAT family members inform our understanding of Mouse Mboat4 structure and mechanism?

Recent structural studies of MBOAT family members have revolutionized our understanding of Mouse Mboat4 through comparative analysis and structural modeling. Key insights include:

  • Identification of a conserved "MBOAT fold" featuring multiple transmembrane helices that create a hydrophobic cavity for substrate binding

  • Elucidation of the relative positions of catalytically essential His and Asn residues within the transmembrane domains

  • Recognition of distinct architectural features that correlate with substrate preference (protein/peptide vs. lipid substrates)

  • Characterization of potential substrate entry channels and product exit paths within the membrane

The explosion of structural information from computational modeling, crystallography, and cryoelectron microscopy has revealed that while all MBOATs share certain conserved features, there are distinct architectural elements that correlate with different acylation substrates. For Mouse Mboat4 specifically, these studies suggest a catalytic mechanism involving coordination between the conserved His-Asn pair and precise positioning of the ghrelin peptide Ser3 residue within the active site cavity .

MBOAT Family MemberPrimary SubstrateAcyl Chain PreferenceStructural Features Relevant to Mboat4
GOAT/Mboat4Ghrelin peptideOctanoyl-CoA (C8)Conserved His-Asn catalytic pair
PORCNWnt proteinsPalmitoleoyl-CoA (C16:1)Similar protein substrate channel
HHATHedgehog proteinsPalmitoyl-CoA (C16)Similar protein substrate channel
DGAT1DiacylglycerolVarious acyl-CoAsDistinct substrate binding architecture
LPCAT3/MBOAT5LysophospholipidsUnsaturated acyl-CoAsDistinct substrate binding architecture

What are the critical residues in Mouse Mboat4 required for catalytic activity, and how can they be experimentally validated?

Critical residues in Mouse Mboat4 required for catalytic activity include conserved histidine and asparagine residues within the transmembrane domains, similar to other MBOAT family members. Experimental validation of these residues involves:

  • Site-directed mutagenesis of conserved His and Asn residues, particularly the predicted catalytic His and Asn residues (analogous to those identified in other MBOATs)

  • Expression of mutant constructs in HEK293T cells and preparation of microsomes

  • Comparative activity assays between wild-type and mutant enzymes using standardized ghrelin acylation assays

  • Structural integrity validation through protein expression analysis and membrane integration assessment

Studies on other MBOAT family members have demonstrated that mutations to the conserved Asn and His residues result in loss of acyltransferase activity. In LPIAT1/MBOAT7, for example, mutations to conserved Asn321 and His356 eliminated activity. Similar effects would be expected for the corresponding residues in Mouse Mboat4 .

How do membrane composition and lipid environment affect recombinant Mouse Mboat4 activity in experimental systems?

Membrane composition and lipid environment significantly influence recombinant Mouse Mboat4 activity through several mechanisms:

  • Membrane fluidity affects enzyme conformational dynamics and substrate accessibility

  • Specific lipids may serve as allosteric regulators of enzyme activity

  • Charged lipids create local electrostatic environments that influence substrate binding

  • Membrane thickness impacts the proper folding and orientation of transmembrane helices

Experimental approaches to investigate these effects include:

  • Reconstitution of purified Mboat4 into liposomes of defined lipid composition

  • Systematic variation of cholesterol content, phospholipid head groups, and acyl chain saturation

  • Activity assays comparing enzyme function across different membrane environments

  • Fluorescence-based assays to monitor conformational changes in response to lipid composition alterations

Research on related MBOAT family members suggests that specific phospholipids, particularly those with unsaturated acyl chains, may enhance enzyme activity by promoting proper folding and maintaining the optimal orientation of catalytic residues .

What are the most effective inhibitors of Mouse Mboat4 for research applications, and how are they experimentally validated?

The most effective inhibitors of Mouse Mboat4 for research applications include bisubstrate analogs and small molecule compounds. The bisubstrate analog GO-CoA-Tat represents a significant advance in this area. Experimental validation involves:

  • In vitro inhibition assays using microsomal preparations containing recombinant Mboat4

  • Determination of IC50 and Ki values through dose-response experiments

  • Evaluation of inhibition mechanism (competitive, non-competitive, or uncompetitive) through kinetic analysis

  • Selectivity profiling against other acyltransferases to confirm specificity

  • Cellular assays measuring inhibition of ghrelin octanoylation in cell culture systems

  • In vivo validation in mouse models, measuring effects on active ghrelin levels and physiological outcomes

The bisubstrate analog GO-CoA-Tat has been demonstrated to modulate weight and blood glucose in mice, confirming its ability to inhibit Mboat4 activity in vivo. This compound combines features of both the acyl-CoA donor and ghrelin peptide substrate, creating a high-affinity inhibitor that occupies both substrate binding sites .

How do species differences between mouse and human Mboat4 impact inhibitor development and translational research?

Species differences between mouse and human Mboat4 impact inhibitor development and translational research in several significant ways:

  • Sequence variations in substrate binding regions may alter inhibitor affinity

  • Differences in post-translational modifications can affect enzyme stability and activity

  • Species-specific interactions with membrane components may influence inhibitor accessibility

  • Metabolic processing of inhibitors may vary between species

A methodological approach to address these challenges includes:

  • Comparative sequence analysis and homology modeling to identify conserved and divergent regions

  • Parallel testing of inhibitors against both mouse and human recombinant Mboat4

  • Development of humanized mouse models expressing human Mboat4 for more predictive in vivo studies

  • Structure-activity relationship studies to identify inhibitor modifications that improve cross-species activity

While mouse models are invaluable for initial validation, researchers must carefully consider species differences when extrapolating results to human applications. Compound modifications may be necessary to optimize activity against human Mboat4 before clinical translation .

What experimental models best demonstrate the physiological effects of Mouse Mboat4 inhibition in metabolic disease research?

The most informative experimental models for demonstrating physiological effects of Mouse Mboat4 inhibition in metabolic disease research include:

  • Genetic models:

    • Mboat4 knockout mice (complete elimination of activity)

    • Conditional/tissue-specific Mboat4 knockout models (targeted deletion)

    • Mboat4 knockin models with catalytically inactive mutations

  • Pharmacological models:

    • Administration of GO-CoA-Tat or other validated Mboat4 inhibitors

    • Dose-response studies correlating inhibition level with physiological outcomes

    • Temporal inhibition studies (acute vs. chronic administration)

  • Diet-induced obesity models treated with Mboat4 inhibitors:

    • High-fat diet models to induce metabolic dysfunction

    • Measurement of weight, food intake, glucose tolerance, and insulin sensitivity

    • Analysis of lipid profiles and inflammatory markers

Research has demonstrated that inhibition of Mboat4 using bisubstrate analogs like GO-CoA-Tat can modulate weight and blood glucose levels in mice, supporting the potential of Mboat4 as a therapeutic target for obesity and diabetes mellitus. The most comprehensive studies combine multiple approaches, correlating molecular-level inhibition with physiological outcomes .

How can structural biology techniques be optimized for studying membrane-integrated Mouse Mboat4?

Optimizing structural biology techniques for studying membrane-integrated Mouse Mboat4 requires specialized approaches that address the challenges of membrane protein analysis:

  • Cryo-electron microscopy (cryo-EM) optimization:

    • Development of suitable detergent or nanodisc systems that maintain native structure

    • Implementation of lipid nanodiscs to preserve the native membrane environment

    • Application of focused refinement techniques to enhance resolution of transmembrane regions

    • Use of stabilizing antibody fragments or designed ankyrin repeat proteins (DARPins) to facilitate particle alignment

  • X-ray crystallography adaptations:

    • Lipidic cubic phase crystallization methods

    • Engineering of fusion proteins to increase soluble domains for crystal contacts

    • Surface entropy reduction through targeted mutations

    • Antibody-mediated crystallization approaches

  • Integrative approaches:

    • Combining computational modeling with sparse experimental constraints

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Cross-linking mass spectrometry to determine proximity relationships between domains

    • Electron paramagnetic resonance spectroscopy to measure distances between specific residues

Recent progress in MBOAT structural biology has been driven by new solubilization approaches coupled with computational modeling, crystallography, and cryoelectron microscopy, leading to an explosion of structural information for multiple MBOAT family members .

What are the current challenges in developing robust high-throughput screening assays for Mouse Mboat4 inhibitors?

Developing robust high-throughput screening assays for Mouse Mboat4 inhibitors faces several technical challenges:

  • Membrane protein stability issues:

    • Maintaining enzyme activity during solubilization and assay preparation

    • Preventing aggregation while preserving native conformation

    • Ensuring consistent incorporation into membrane mimetics

  • Detection method limitations:

    • Creating sensitive, non-radioactive detection systems for acyltransferase activity

    • Developing homogeneous assay formats compatible with automation

    • Minimizing background signal from non-specific interactions

  • Substrate complexity challenges:

    • Synthesizing modified ghrelin peptides with detection tags

    • Balancing substrate modifications with maintaining native recognition

    • Ensuring cost-effective production of substrates for large-scale screening

Methodological solutions include:

  • Development of fluorescence resonance energy transfer (FRET) or time-resolved FRET assays with labeled peptide substrates

  • Creation of stable cell lines expressing Mboat4 for cellular screening approaches

  • Implementation of bioluminescence resonance energy transfer (BRET) systems to monitor enzyme-substrate interactions

  • Adaptation of AlphaScreen or AlphaLISA technologies for detection of acylated products

These approaches must be carefully validated against established biochemical assays to ensure they accurately reflect inhibition of the enzyme's catalytic activity rather than artifact signals from assay components .

How might novel computational approaches advance our understanding of Mouse Mboat4 substrate recognition and catalytic mechanism?

Novel computational approaches offer significant potential to advance understanding of Mouse Mboat4 substrate recognition and catalytic mechanism through multiple complementary strategies:

  • Advanced molecular dynamics simulations:

    • Umbrella sampling to determine free energy profiles of substrate binding

    • Steered molecular dynamics to model substrate entry and product exit pathways

    • Coarse-grained simulations to observe membrane deformation during catalysis

    • Quantum mechanics/molecular mechanics (QM/MM) approaches to model the reaction mechanism

  • Machine learning applications:

    • Development of neural network models to predict substrate specificity

    • Identification of pharmacophore features for inhibitor design

    • Generative models to propose novel inhibitor scaffolds

    • Analysis of sequence-structure-function relationships across the MBOAT family

  • Integrative structural modeling:

    • Refinement of homology models using sparse experimental data

    • Prediction of protein-substrate complexes through docking and scoring

    • Molecular interaction fingerprinting to identify key binding determinants

    • Evolutionary coupling analysis to identify co-evolving residue networks

These computational approaches can generate testable hypotheses about substrate recognition determinants, catalytic mechanisms, and inhibitor binding modes. The integration of computational predictions with targeted experimental validation represents a powerful approach for advancing understanding of this challenging membrane enzyme system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.