Recombinant Mouse GLIPR1-like protein 2 (Glipr1l2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Glipr1l2; GLIPR1-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Glipr1l2
Target Protein Sequence
MKASLPWSVVWRAQSNYVRLRRVLKLCELWLLLVGSGLNAKLPLEEDVDFINEYVGLHNE LRGTVFPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPVFTEIGENMWVG PVEDFTVTTAIRSWHEERKSYSYLNDTCVEDQNCSHYIQLVWDSSYKVGCAVTSCARAGG FTHAALFICNYAPGGTLTRRPYQAGQFCSRCGPGDQCTDYLCSNTVRDEATYYQFWYPPW EKPRPVVCNPMCIFILFLRVASLLLCVIVVLIVQSRFPVILMETPTIISAEEEGKTEVEI VMEEGEGEGEGGEGEGEGEEKEEEEMLEEDEQ
Uniprot No.

Target Background

Gene References Into Functions
  1. Growth inhibition is partially rescued by ectopic Gli1 expression, suggesting Fu's contribution to enhanced Hh signaling activity in cancer cells. PMID: 17054904
Database Links
Protein Families
CRISP family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Glipr1l2 and how does it relate to other GLIPR family proteins?

Glipr1l2 (GLIPR1-like protein 2) is a member of the CRISP (Cysteine-Rich Secretory Protein) family, closely related to GLIPR1. Like GLIPR1, it's a single-pass membrane protein with structural similarities to other family members. GLIPR1 itself has been characterized as a protein with a molecular mass of approximately 25.1 kDa, and Glipr1l2 shares similar structural properties due to their evolutionary relationship . The GLIPR family proteins contain conserved cysteine-rich domains that contribute to their tertiary structure and biological functions.

What are the typical expression patterns of Glipr1l2 in mouse tissues?

While the provided search results don't specifically detail Glipr1l2 expression patterns, we can extrapolate from GLIPR1 data that these family proteins often show tissue-specific expression. In the case of GLIPR1, expression levels vary significantly between tissues, with particularly notable differences between normal and pathological states. Research suggests that GLIPR1 expression is low in normal brain tissue but elevated in glioblastomas . For accurate Glipr1l2-specific expression data, researchers should conduct tissue-specific RT-PCR or consult gene expression databases that catalog mouse tissue transcriptomes.

What are the optimal storage conditions for recombinant Glipr1l2?

For optimal stability of recombinant proteins in the GLIPR family:

FormStorage ConditionStability Period
Lyophilized protein-20°C to -80°CUp to 12 months
Reconstituted protein solution4-8°C2-7 days
Aliquoted reconstituted samples<-20°CUp to 3 months

To maintain protein integrity, avoid repeated freeze-thaw cycles. When preparing the protein for long-term storage, consider adding stabilizing agents like trehalose, mannitol (5-8%), and 0.01% Tween 80 before lyophilization .

How can I validate the biological activity of recombinant Glipr1l2?

Biological activity validation for Glipr1l2 would follow similar approaches used for related proteins like GLIPR1. Consider these methodological approaches:

  • Functional assays: Design cell-based assays to evaluate the protein's effect on proliferation, apoptosis, or migration, depending on the known or hypothesized function.

  • Binding studies: If binding partners are known, conduct co-immunoprecipitation or surface plasmon resonance experiments.

  • Downstream signaling: Assess activation of pathways known to be affected by Glipr1l family proteins, such as examining cell cycle markers or apoptosis markers.

  • Phenotypic rescue: In cells where endogenous Glipr1l2 has been knocked down, determine if the recombinant protein can restore normal phenotypes .

What are the key technical considerations when designing Glipr1l2 expression or knockdown experiments?

When designing expression or knockdown experiments:

  • Control for nuisance variables: Factors such as reagent lot, day of extraction, and technicians can introduce unwanted variation. Either eliminate these variables or distribute them evenly across treatment groups to avoid bias .

  • Choose appropriate controls: For overexpression studies, include empty vector controls. For knockdown studies, use non-targeting siRNA/shRNA controls.

  • Validation of expression/knockdown: Always verify the level of Glipr1l2 modulation using qRT-PCR and western blotting.

  • Cell type selection: Consider using cell types that naturally express Glipr1l2 or are relevant to its hypothesized function.

  • Timing considerations: Monitor the effects over time, as immediate responses may differ from long-term adaptations to altered Glipr1l2 levels .

How does Glipr1l2 function in normal physiological processes?

While the search results don't specifically address Glipr1l2 function, we can draw parallels from GLIPR1 research. Based on the CRISP family characteristics, Glipr1l2 likely plays roles in cellular processes including proliferation, differentiation, or immune response. The functional characterization would require:

  • Expression profiling across tissues and developmental stages

  • Identification of binding partners through techniques like yeast two-hybrid, co-immunoprecipitation, or proximity labeling methods

  • Phenotypic studies of knockout/knockdown models

  • Investigation of signaling pathways affected by Glipr1l2 presence or absence

Given the context-specific roles observed with GLIPR1, where it can act as a tumor suppressor in prostate cancer but promotes cell growth in glioblastomas, researchers should be prepared for potentially diverse functions of Glipr1l2 depending on cellular context .

What microarray or RNA-seq approaches are most informative for studying Glipr1l2-related gene expression networks?

For comprehensive gene expression analysis related to Glipr1l2:

  • Experimental design considerations:

    • Ensure biological replicates (minimum n=3, preferably n≥5)

    • Include appropriate controls (wild-type, vector-only, or non-targeting controls)

    • Control for batch effects by distributing samples evenly across processing batches

  • Analysis approaches:

    • Differential expression analysis to identify genes affected by Glipr1l2 modulation

    • Pathway analysis to understand biological processes impacted

    • Gene Set Enrichment Analysis (GSEA) to identify coordinated changes in gene expression

    • Network analysis to map potential regulatory relationships

  • Validation strategies:

    • qRT-PCR validation of key differentially expressed genes

    • Protein-level validation using western blotting or immunohistochemistry

    • Functional validation through targeted follow-up experiments

What is currently known about Glipr1l2's role in cancer biology compared to GLIPR1?

While specific information about Glipr1l2 in cancer isn't provided in the search results, GLIPR1 shows context-dependent roles:

  • Tumor suppressor role: In prostate cancer, GLIPR1 is downregulated, and its restoration leads to growth suppression and apoptosis. Loss of Glipr1 predisposes mice to tumorigenesis .

  • Oncogenic role: In glioblastomas, GLIPR1 is upregulated and promotes cell proliferation, survival, and invasion .

For Glipr1l2, researchers should investigate:

  • Expression patterns across cancer types compared to normal tissues

  • Effects of overexpression or knockdown on cancer cell phenotypes

  • Potential mechanisms of action, particularly examining whether it affects similar pathways as GLIPR1, such as c-myc and cell cycle regulation

  • Correlation between expression levels and clinical outcomes

How do mutations or polymorphisms in Glipr1l2 affect its function and disease associations?

To study the impact of mutations or polymorphisms:

  • Structural analysis: Use computational approaches to predict how specific mutations might affect protein structure and function.

  • Functional validation: Compare wild-type and mutant forms in:

    • Expression and localization studies

    • Binding assays with known partners

    • Cell-based functional assays

  • Population studies: Examine whether specific variants correlate with disease susceptibility or progression.

  • Mechanistic investigations: For functionally significant variants, determine how they affect downstream pathways, potentially using approaches like those used for GLIPR1, which revealed effects on cell cycle regulators including cyclins A2, B1, B2, D1, CDC25C, and p21 .

How does the regulation of Glipr1l2 differ from other GLIPR family members at the transcriptional and post-transcriptional levels?

This complex question requires multi-level analysis:

  • Promoter analysis: Compare promoter regions of Glipr1l2 and other family members to identify unique or shared transcription factor binding sites.

  • Epigenetic regulation: Investigate methylation patterns, which have been implicated in GLIPR1 regulation in cancer .

  • Transcription factor studies: Identify key transcriptional regulators through ChIP-seq or reporter assays.

  • Post-transcriptional mechanisms: Examine:

    • miRNA targeting predictions and validation

    • mRNA stability assays

    • Alternative splicing patterns

  • Protein stability regulation: Investigate degradation pathways and post-translational modifications that affect protein half-life.

The differing expression patterns between family members in various tissues and disease states suggests distinct regulatory mechanisms that warrant careful comparative studies .

What are the most effective approaches for resolving contradictory findings in Glipr1l2 functional studies?

When facing contradictory results in functional studies:

  • Methodological standardization:

    • Establish consensus protocols for protein production and handling

    • Develop standard assays with clearly defined readouts

    • Use consistent cell lines and experimental conditions

  • Context consideration:

    • Evaluate cell type-specific effects (similar to how GLIPR1 shows opposing roles in different cancers)

    • Examine microenvironmental factors that might influence results

    • Consider protein concentration effects, as dose-dependent responses may vary

  • Technical validation:

    • Use multiple complementary techniques to confirm findings

    • Implement rigorous controls for specificity

    • Consider the impact of tags or fusion partners on protein function

  • Collaborative verification:

    • Establish multi-laboratory validation studies

    • Develop shared resources of validated reagents

    • Create open databases of experimental conditions and results

How can CRISPR-Cas9 genome editing enhance our understanding of Glipr1l2 function?

CRISPR-Cas9 technology offers several powerful approaches for Glipr1l2 research:

  • Knockout studies: Generate complete Glipr1l2 knockout cell lines or animal models to assess loss-of-function phenotypes.

  • Knock-in approaches: Create tagged versions of the endogenous protein for localization studies or introduce specific mutations to test structure-function hypotheses.

  • Promoter editing: Modify regulatory regions to understand transcriptional control.

  • CRISPRi/CRISPRa: Use modified CRISPR systems for targeted repression or activation of Glipr1l2 expression without altering the genomic sequence.

  • Screening applications: Conduct CRISPR screens to identify genes that synthetically interact with Glipr1l2, revealing functional pathways and potential compensatory mechanisms.

The ability to precisely modify the genome allows researchers to move beyond correlative studies toward definitive functional characterization in physiologically relevant contexts .

What systems biology approaches might reveal new insights about Glipr1l2's role in broader cellular networks?

Integrative systems biology approaches for Glipr1l2 research include:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, metabolomics, and epigenomics data

    • Use computational methods to identify patterns across different data types

    • Develop predictive models of Glipr1l2 function in cellular networks

  • Network analysis:

    • Construct protein-protein interaction networks centered on Glipr1l2

    • Identify network motifs and regulatory circuits

    • Compare network perturbations across different experimental conditions

  • Temporal dynamics:

    • Study time-course responses to Glipr1l2 modulation

    • Develop mathematical models of pathway dynamics

    • Identify feedback and feed-forward loops in Glipr1l2-related signaling

  • Single-cell approaches:

    • Apply single-cell RNA-seq to capture heterogeneity in responses

    • Use trajectory analysis to understand developmental or state-transition roles

    • Combine with spatial transcriptomics for tissue context

These approaches can help contextualize Glipr1l2 function within broader cellular systems, revealing emergent properties not apparent from reductionist studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.